StarFunc result for job id Q96BW1

User Input

>input (309 residues)
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSL
PAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIR
ELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNC
GVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPI
LSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTH
FGQKYFGTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8KAF9	0.786	0.786	6.742E-57	309	1.000	1.000	A8KAF9.pdb.gz	A8KAF9_HUMAN UPP OS=Homo sapiens OX=9606 GN=RP11-311P8.3 PE=2 SV=1
2	AFDB:M9PHI7	0.661	0.781	3.770E-35	261	0.460	0.544	M9PHI7.pdb.gz	M9PHI7_DROME Krishah, isoform B OS=Drosophila melanogaster OX=7227 GN=kri PE=1 SV=1
3	AFDB:O13867	0.637	0.895	5.022E-29	219	0.324	0.457	O13867.pdb.gz	UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B3.01c PE=3 SV=1
4	AFDB:Q8VYB2	0.659	0.441	7.631E-29	466	0.320	0.212	Q8VYB2.pdb.gz	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
5	AFDB:P18562	0.625	0.888	1.563E-28	216	0.317	0.454	P18562.pdb.gz	UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUR1 PE=1 SV=2
6	AFDB:Q9U3L5	0.653	0.867	4.583E-28	231	0.353	0.472	Q9U3L5.pdb.gz	Q9U3L5_CAEEL Uracil phosphoribosyltransferase homolog OS=Caenorhabditis elegans OX=6239 GN=C47B2.2 PE=1 SV=1
7	AFDB:Q9FKS0	0.646	0.415	1.514E-27	486	0.314	0.200	Q9FKS0.pdb.gz	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
8	AFDB:Q9HE15	0.635	0.884	7.571E-25	220	0.243	0.341	Q9HE15.pdb.gz	UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1399.04c PE=3 SV=1
9	AFDB:Q9NWZ5	0.640	0.363	1.296E-24	548	0.278	0.157	Q9NWZ5.pdb.gz	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
10	AFDB:H2L2A8	0.640	0.351	1.455E-22	569	0.243	0.132	H2L2A8.pdb.gz	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
11	PDB:2ehjA	0.571	0.824	1.990E-17	208	0.155	0.231	2ehjA.pdb.gz
12	PDB:5e38D	0.553	0.778	4.432E-14	213	0.120	0.174	5e38D.pdb.gz
13	PDB:5e38B	0.482	0.815	3.462E-10	175	0.100	0.177	5e38B.pdb.gz
14	PDB:6mxcC	0.325	0.439	7.035E-6	220	0.094	0.132	6mxcC.pdb.gz	Crystal structures of Trypanosoma brucei hypoxanthine - guanine - xanthine phosphoribosyltransferase in complex with IMP, GMP and XMP.
15	PDB:2jbhB	0.303	0.417	1.530E-5	213	0.071	0.103	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
16	PDB:1a95B	0.308	0.583	2.324E-5	150	0.068	0.140	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
17	PDB:1bzyA	0.289	0.386	5.055E-5	214	0.087	0.126	1bzyA.pdb.gz	The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
18	PDB:2dy0A	0.369	0.583	5.366E-5	182	0.094	0.159	2dy0A.pdb.gz
19	PDB:5knxB	0.313	0.513	6.047E-5	176	0.081	0.142	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
20	PDB:5knyB	0.339	0.530	7.235E-5	187	0.061	0.102	5knyB.pdb.gz	Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRR5	0.0	569	281	0.896	0.986	A0A0A0MRR5_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens OX=9606 GN=UPRT PE=1 SV=1
2	A0A8I6G3Q5	0.0	541	309	0.854	0.854	A0A8I6G3Q5_RAT Uracil phosphoribosyltransferase homolog OS=Rattus norvegicus OX=10116 GN=Uprt PE=4 SV=1
3	A8KAF9	0.0	639	309	1.000	1.000	A8KAF9_HUMAN UPP OS=Homo sapiens OX=9606 GN=RP11-311P8.3 PE=2 SV=1
4	Q96BW1	0.0	639	309	1.000	1.000	UPP_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens OX=9606 GN=UPRT PE=1 SV=1
5	E9PSD7	2.73e-126	359	173	0.560	1.000	E9PSD7_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens OX=9606 GN=UPRT PE=1 SV=1
6	A0A494C0H3	4.97e-107	310	149	0.482	1.000	A0A494C0H3_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens OX=9606 GN=UPRT PE=1 SV=1
7	Q9VRQ1	2.63e-99	294	261	0.447	0.529	Q9VRQ1_DROME Krishah, isoform A OS=Drosophila melanogaster OX=7227 GN=kri PE=1 SV=1
8	M9PHI7	1.00e-96	288	261	0.437	0.517	M9PHI7_DROME Krishah, isoform B OS=Drosophila melanogaster OX=7227 GN=kri PE=1 SV=1
9	Q9U3L5	5.97e-69	216	231	0.343	0.459	Q9U3L5_CAEEL Uracil phosphoribosyltransferase homolog OS=Caenorhabditis elegans OX=6239 GN=C47B2.2 PE=1 SV=1
10	O13867	1.57e-61	196	219	0.327	0.461	UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1B3.01c PE=3 SV=1
11	P18562	3.69e-59	190	216	0.307	0.440	UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUR1 PE=1 SV=2
12	Q8VYB2	3.97e-56	190	466	0.324	0.215	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
13	Q9FKS0	1.49e-54	186	486	0.317	0.202	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
14	Q9LK34	4.67e-54	185	483	0.314	0.201	UKL2_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL2 PE=1 SV=1
15	Q9NWZ5	5.50e-44	159	548	0.282	0.159	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
16	Q9HE15	4.49e-39	139	220	0.246	0.345	UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1399.04c PE=3 SV=1
17	H2L2A8	1.20e-37	142	569	0.236	0.128	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
18	O74427	8.19e-21	94.4	454	0.197	0.134	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
19	P27515	1.93e-20	93.6	501	0.210	0.130	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
20	P9WFF3	2.75e-08	55.5	207	0.117	0.174	UPP_MYCTU Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=upp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00156 Pribosyltran	6.8	17.5	Phosphoribosyl transferase domain
2	PF14681 UPRTase	1.6e-49	179.7	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346155	0.997	Uridine-cytidine kinase-like 1
2	9606.ENSP00000361285	0.994	Uridine-cytidine kinase 1
3	9606.ENSP00000356853	0.993	Uridine-cytidine kinase 2
4	9606.ENSP00000232607	0.989	Uridine 5'-monophosphate synthase
5	9606.ENSP00000330032	0.967	Uridine phosphorylase 1
6	9606.ENSP00000379038	0.967	Thymidine phosphorylase
7	9606.ENSP00000474090	0.963	Uridine phosphorylase 2
8	9606.ENSP00000354532	0.961	Purine nucleoside phosphorylase
9	9606.ENSP00000359211	0.952	Dihydropyrimidine dehydrogenase [NADP(+)]
10	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
11	9606.ENSP00000256722	0.930	UMP-CMP kinase 2, mitochondrial
12	9606.ENSP00000257770	0.924	5'-nucleotidase
13	9606.ENSP00000335246	0.919	Ectonucleoside triphosphate diphosphohydrolase 5
14	9606.ENSP00000301825	0.915	Ectonucleoside triphosphate diphosphohydrolase 3
15	9606.ENSP00000307674	0.902	Soluble calcium-activated nucleotidase 1
16	9606.ENSP00000360250	0.902	Ectonucleoside triphosphate diphosphohydrolase 1
17	9606.ENSP00000360561	0.901	Ectonucleoside triphosphate diphosphohydrolase 8
18	9606.ENSP00000235628	0.900	Cytosolic 5'-nucleotidase 1A
19	9606.ENSP00000245552	0.900	5'(3')-deoxyribonucleotidase, cytosolic type
20	9606.ENSP00000339479	0.900	Cytosolic purine 5'-nucleotidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016740	0.999	transferase activity
GO:0005515	0.996	protein binding
GO:0016763	0.991	pentosyltransferase activity
GO:0004845	0.748	uracil phosphoribosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0006725	0.996	cellular aromatic compound metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0018130	0.996	heterocycle biosynthetic process
GO:0044281	0.995	small molecule metabolic process
GO:1901362	0.995	organic cyclic compound biosynthetic process
GO:0019438	0.991	aromatic compound biosynthetic process
GO:0044271	0.991	cellular nitrogen compound biosynthetic process
GO:0009117	0.988	nucleotide metabolic process
GO:0009123	0.982	nucleoside monophosphate metabolic process
GO:0009165	0.981	nucleotide biosynthetic process
GO:0009259	0.966	ribonucleotide metabolic process
GO:0006220	0.958	pyrimidine nucleotide metabolic process
GO:1901566	0.949	organonitrogen compound biosynthetic process
GO:0009124	0.938	nucleoside monophosphate biosynthetic process
GO:1901137	0.924	carbohydrate derivative biosynthetic process
GO:0009129	0.908	pyrimidine nucleoside monophosphate metabolic process
GO:0006221	0.908	pyrimidine nucleotide biosynthetic process
GO:0009218	0.897	pyrimidine ribonucleotide metabolic process
GO:0065007	0.870	biological regulation
GO:0046390	0.824	ribose phosphate biosynthetic process
GO:0048856	0.805	anatomical structure development
GO:0009161	0.581	ribonucleoside monophosphate metabolic process
GO:0009260	0.578	ribonucleotide biosynthetic process
GO:0009156	0.551	ribonucleoside monophosphate biosynthetic process
GO:0051179	0.492	localization
GO:0050896	0.488	response to stimulus
GO:0006810	0.408	transport
GO:0032501	0.399	multicellular organismal process
GO:0050878	0.388	regulation of body fluid levels
GO:0030879	0.359	mammary gland development
GO:0007589	0.358	body fluid secretion
GO:0000003	0.331	reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.
EC:2.4.2.-	0.991	Pentosyltransferases.
RHEA:13017	0.748	diphosphate + UMP = 5-phospho-alpha-D-ribose 1-diphosphate + uracil
EC:2.4.2.9	0.748	uracil phosphoribosyltransferase.

[back to server]