StarFunc result for job id Q96BW9

User Input

>input (452 residues)
MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVA
WHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIE
DLLNWNNLYIAGRLQKPVKIISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIE
IAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKS
PEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLSAIVRPS
SIRQSTKGIFTAGKSFGNPCVTYLLTEWLPHSWLQCKALYLLGACEMLSFDGHKLGYCSK
VQTGITAAEPGGRTMSDHWQCCWKLYCPSEFSETLPVCRVFPSYCFIYQSYRCIGLQKQQ
HLCSPSSSPSLRQLLPSVLVGYFCCYCHFSKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BW9	1.000	1.000	2.961E-78	452	1.000	1.000	Q96BW9.pdb.gz	TAM41_HUMAN Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41 PE=1 SV=2
2	AFDB:D3ZKT0	0.679	0.907	4.135E-50	337	0.569	0.763	D3ZKT0.pdb.gz	TAM41_RAT Phosphatidate cytidylyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tamm41 PE=1 SV=1
3	AFDB:O74339	0.621	0.712	2.406E-28	393	0.265	0.305	O74339.pdb.gz	TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tam41 PE=1 SV=3
4	AFDB:A0A1D8PND1	0.613	0.592	4.267E-23	469	0.226	0.217	A0A1D8PND1.pdb.gz	A0A1D8PND1_CANAL Phosphatidate cytidylyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTH1 PE=3 SV=1
5	PDB:3jyyB	0.177	0.267	4.525E-3	266	0.097	0.165	3jyyB.pdb.gz	Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
6	PDB:6xz0A	0.188	0.301	4.767E-3	250	0.102	0.184	6xz0A.pdb.gz	Structural Recognition of Spectinomycin by Resistance Enzyme ANT(9) from Enterococcus faecalis.
7	PDB:5lpaA	0.175	0.262	2.952E-2	267	0.073	0.124	5lpaA.pdb.gz	Structural mechanism of AadA, a dual-specificity aminoglycoside adenylyltransferase fromSalmonella enterica.
8	AFDB:A0A0A7MA29	0.125	0.122	3.430E-2	472	0.106	0.102	A0A0A7MA29.pdb.gz	A0A0A7MA29_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 PE=2 SV=1
9	AFDB:Q7K126	0.074	0.049	5.774E-2	844	0.102	0.055	Q7K126.pdb.gz	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
10	AFDB:Q57XY9	0.117	0.132	7.112E-2	380	0.093	0.111	Q57XY9.pdb.gz	Q57XY9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.80 PE=4 SV=1
11	AFDB:Q9N4F3	0.096	0.059	7.492E-2	955	0.106	0.050	Q9N4F3.pdb.gz	Q9N4F3_CAEEL AP complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-1 PE=1 SV=2
12	AFDB:P32240	0.133	0.126	7.893E-2	513	0.104	0.092	P32240.pdb.gz	PE2R4_MOUSE Prostaglandin E2 receptor EP4 subtype OS=Mus musculus OX=10090 GN=Ptger4 PE=1 SV=1
13	AFDB:Q1JPS6	0.103	0.097	1.137E-1	500	0.108	0.098	Q1JPS6.pdb.gz	OPN4L_DANRE Melanopsin-like OS=Danio rerio OX=7955 GN=opn4l PE=2 SV=1
14	PDB:5wyjCB	0.171	0.103	1.205E-1	1098	0.095	0.039	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:3hj1B	0.144	0.161	2.922E-1	387	0.088	0.103	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
16	PDB:1qz4A	0.095	0.154	3.994E-1	213	0.066	0.141	1qz4A.pdb.gz
17	PDB:3euhC	0.143	0.261	4.432E-1	206	0.055	0.121	3euhC.pdb.gz
18	PDB:6pojA	0.110	0.139	5.459E-1	292	0.088	0.137	6pojA.pdb.gz
19	PDB:8d0bB	0.124	0.149	6.383E-1	362	0.097	0.122	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
20	PDB:7uzqK	0.102	0.116	8.282E-1	380	0.069	0.082	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZKT0	0.0	545	337	0.564	0.757	TAM41_RAT Phosphatidate cytidylyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tamm41 PE=1 SV=1
2	Q3TUH1	0.0	548	337	0.569	0.763	TAM41_MOUSE Phosphatidate cytidylyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Tamm41 PE=1 SV=2
3	Q96BW9	0.0	942	452	1.000	1.000	TAM41_HUMAN Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41 PE=1 SV=2
4	O74339	1.24e-55	191	393	0.263	0.303	TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tam41 PE=1 SV=3
5	P53230	2.29e-38	145	385	0.190	0.223	TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAM41 PE=1 SV=1
6	A0A1D8PND1	9.14e-35	137	469	0.190	0.183	A0A1D8PND1_CANAL Phosphatidate cytidylyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTH1 PE=3 SV=1
7	Q9FF41	2.4	33.1	579	0.027	0.021	PMI15_ARATH Protein PLASTID MOVEMENT IMPAIRED 15 OS=Arabidopsis thaliana OX=3702 GN=PMI15 PE=2 SV=3
8	Q858F5	2.5	33.1	1070	0.073	0.031	FIBER_BPE15 Tail spike protein OS=Salmonella phage epsilon15 OX=215158 PE=1 SV=1
9	Q8ND30	4.5	32.3	876	0.073	0.038	LIPB2_HUMAN Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3
10	Q07448	4.8	31.6	255	0.042	0.075	S9AD_ENTFL Spectinomycin 9-adenylyltransferase OS=Enterococcus faecalis OX=1351 GN=spc PE=1 SV=1
11	Q386C5	7.2	31.6	802	0.029	0.016	Q386C5_TRYB2 N(2), N(2)-dimethylguanosine tRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1390 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14496 NEL	3.4e+02	12.0	C-terminal novel E3 ligase, LRR-interacting
2	PF11091 T4_tail_cap	1.3e+02	13.0	Tail-tube assembly protein
3	PF09139 Tam41_Mmp37	1.6e-101	351.6	Phosphatidate cytidylyltransferase, mitochondrial

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003826311.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003821394.1	0.715	Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin
2	9597.XP_003815273.1	0.700	Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
3	9597.XP_003832288.1	0.678	Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin
4	9597.XP_003818318.1	0.673	Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin
5	9597.XP_003821404.1	0.672	Cardiolipin synthase 1
6	9597.XP_003828944.1	0.671	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
7	9597.XP_003810896.1	0.653	MRG/MORF4L-binding protein
8	9597.XP_008963433.1	0.653	Era like 12S mitochondrial rRNA chaperone 1
9	9597.XP_008949013.1	0.649	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 isoform X1
10	9597.XP_008959843.1	0.611	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
11	9597.XP_003807709.1	0.608	Mab-21 domain containing 2
12	9597.XP_003828701.1	0.591	Eukaryotic translation initiation factor 1A domain containing
13	9597.XP_003824470.1	0.589	Family with sequence similarity 46 member D
14	9597.XP_008952418.1	0.588	Phosphatidylinositol transfer protein membrane associated 1
15	9597.XP_003832436.1	0.583	TP53-regulated inhibitor of apoptosis 1
16	9597.XP_008967545.1	0.581	Mitochondrial ribosome-associated GTPase 1 isoform X1
17	9597.XP_008950930.1	0.578	Some isoforms may be involved in cardiolipin metabolism.
18	9597.XP_003805674.1	0.566	Protein mab-21-like 3
19	9597.XP_003813120.1	0.565	Chromosome 2B open reading frame, human C2orf54
20	9597.XP_003821496.1	0.562	poly(A) RNA polymerase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.967	catalytic activity
GO:0016740	0.826	transferase activity
GO:0016772	0.501	transferase activity, transferring phosphorus-containing groups
GO:0016779	0.431	nucleotidyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0009987	0.991	cellular process
GO:0044238	0.973	primary metabolic process
GO:0044237	0.968	cellular metabolic process
GO:1901576	0.966	organic substance biosynthetic process
GO:0006796	0.962	phosphate-containing compound metabolic process
GO:0019637	0.960	organophosphate metabolic process
GO:0044255	0.952	cellular lipid metabolic process
GO:0006644	0.813	phospholipid metabolic process
GO:0090407	0.742	organophosphate biosynthetic process
GO:0006650	0.685	glycerophospholipid metabolic process
GO:0008654	0.642	phospholipid biosynthetic process
GO:0046474	0.630	glycerophospholipid biosynthetic process
GO:0065007	0.359	biological regulation
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005739	0.994	mitochondrion
GO:0016020	0.931	membrane
GO:0031090	0.645	organelle membrane
GO:0031981	0.534	nuclear lumen
GO:0019866	0.487	organelle inner membrane
GO:0005743	0.471	mitochondrial inner membrane
GO:0019898	0.406	extrinsic component of membrane
GO:0005654	0.355	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.826	Transferases.
EC:2.7.-.-	0.501	Transferring phosphorus-containing groups.
EC:2.7.7.-	0.431	Nucleotidyltransferases.

[back to server]