StarFunc result for job id Q96BY2

User Input

>input (351 residues)
MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDE
NRKVALVGLTAETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGEL
SRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEE
FGRWMFHTTQMIKAWQVPDVEKRRRLLESLRGPALDVIRVLKINNPLITVDECLQALEEV
FGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIA
GAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BY2	1.000	1.000	1.256E-63	351	1.000	1.000	Q96BY2.pdb.gz	MOAP1_HUMAN Modulator of apoptosis 1 OS=Homo sapiens OX=9606 GN=MOAP1 PE=1 SV=1
2	AFDB:Q9ERH6	0.609	0.607	1.733E-51	352	0.772	0.770	Q9ERH6.pdb.gz	MOAP1_MOUSE Modulator of apoptosis 1 OS=Mus musculus OX=10090 GN=Moap1 PE=1 SV=1
3	AFDB:Q8ND90	0.538	0.535	4.486E-40	353	0.558	0.555	Q8ND90.pdb.gz	PNMA1_HUMAN Paraneoplastic antigen Ma1 OS=Homo sapiens OX=9606 GN=PNMA1 PE=1 SV=2
4	AFDB:Q9UL41	0.518	0.398	5.502E-35	463	0.462	0.350	Q9UL41.pdb.gz	PNMA3_HUMAN Paraneoplastic antigen Ma3 OS=Homo sapiens OX=9606 GN=PNMA3 PE=1 SV=3
5	AFDB:Q9UL42	0.627	0.608	3.878E-34	364	0.459	0.442	Q9UL42.pdb.gz	PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2
6	AFDB:Q96PV4	0.519	0.417	6.126E-31	448	0.453	0.355	Q96PV4.pdb.gz	PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens OX=9606 GN=PNMA5 PE=1 SV=2
7	AFDB:P0CW24	0.496	0.441	3.454E-30	399	0.387	0.341	P0CW24.pdb.gz	PNM6A_HUMAN Paraneoplastic antigen-like protein 6A OS=Homo sapiens OX=9606 GN=PNMA6A PE=1 SV=2
8	AFDB:Q9CZA5	0.425	0.378	6.026E-15	402	0.214	0.187	Q9CZA5.pdb.gz	ZCH12_MOUSE Zinc finger CCHC domain-containing protein 12 OS=Mus musculus OX=10090 GN=Zcchc12 PE=1 SV=1
9	AFDB:Q6PEW1	0.447	0.396	5.309E-14	402	0.188	0.164	Q6PEW1.pdb.gz	ZCH12_HUMAN Zinc finger CCHC domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZCCHC12 PE=1 SV=2
10	AFDB:Q7K1U0	0.417	0.553	1.071E-4	254	0.085	0.118	Q7K1U0.pdb.gz	ARC1_DROME Activity-regulated cytoskeleton associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Arc1 PE=1 SV=1
11	PDB:6ff7X	0.180	0.334	1.925E-2	171	0.077	0.158	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:7lmaH	0.160	0.262	3.009E-2	199	0.057	0.101	7lmaH.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
13	PDB:5gm6R	0.157	0.201	3.364E-2	261	0.068	0.092	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:6taqA	0.374	0.736	5.257E-2	164	0.080	0.171	6taqA.pdb.gz
15	PDB:3pgwP	0.180	0.471	5.877E-2	113	0.054	0.168	3pgwP.pdb.gz
16	PDB:6t61A	0.193	0.285	8.214E-2	217	0.091	0.147	6t61A.pdb.gz
17	PDB:6tapD	0.369	0.706	8.214E-2	166	0.066	0.139	6tapD.pdb.gz
18	PDB:3lqvB	0.161	0.409	1.435E-1	115	0.046	0.139	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	PDB:5mguA	0.118	0.103	1.435E-1	407	0.017	0.015	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.
20	PDB:6exnN	0.154	0.214	2.006E-1	242	0.043	0.062	6exnN.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BY2	0.0	711	351	1.000	1.000	MOAP1_HUMAN Modulator of apoptosis 1 OS=Homo sapiens OX=9606 GN=MOAP1 PE=1 SV=1
2	Q9ERH6	0.0	540	352	0.772	0.770	MOAP1_MOUSE Modulator of apoptosis 1 OS=Mus musculus OX=10090 GN=Moap1 PE=1 SV=1
3	Q8ND90	5.70e-127	370	353	0.570	0.567	PNMA1_HUMAN Paraneoplastic antigen Ma1 OS=Homo sapiens OX=9606 GN=PNMA1 PE=1 SV=2
4	Q8VHZ4	5.69e-126	367	353	0.564	0.561	PNMA1_RAT Paraneoplastic antigen Ma1 homolog OS=Rattus norvegicus OX=10116 GN=Pnma1 PE=2 SV=1
5	Q96PV4	2.48e-100	305	448	0.464	0.364	PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens OX=9606 GN=PNMA5 PE=1 SV=2
6	Q9UL42	9.33e-98	296	364	0.442	0.426	PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2
7	Q9UL41	6.06e-96	294	463	0.453	0.343	PNMA3_HUMAN Paraneoplastic antigen Ma3 OS=Homo sapiens OX=9606 GN=PNMA3 PE=1 SV=3
8	P0CW24	1.15e-67	219	399	0.407	0.358	PNM6A_HUMAN Paraneoplastic antigen-like protein 6A OS=Homo sapiens OX=9606 GN=PNMA6A PE=1 SV=2
9	Q9CZA5	3.07e-32	126	402	0.228	0.199	ZCH12_MOUSE Zinc finger CCHC domain-containing protein 12 OS=Mus musculus OX=10090 GN=Zcchc12 PE=1 SV=1
10	Q6PEW1	3.06e-24	104	402	0.157	0.137	ZCH12_HUMAN Zinc finger CCHC domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZCCHC12 PE=1 SV=2
11	Q9H0W5	2.80e-04	45.1	538	0.057	0.037	CCDC8_HUMAN Coiled-coil domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CCDC8 PE=1 SV=2
12	P51857	0.052	37.7	326	0.066	0.071	AK1D1_HUMAN Aldo-keto reductase family 1 member D1 OS=Homo sapiens OX=9606 GN=AKR1D1 PE=1 SV=1
13	Q9EQJ9	1.1	33.9	1476	0.066	0.016	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
14	Q5F488	1.5	33.5	1128	0.066	0.020	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
15	Q57TZ5	2.6	32.7	746	0.083	0.039	Q57TZ5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29D18.90 PE=4 SV=1
16	O26981	2.7	30.0	77	0.051	0.234	THIRX_METTH Thioredoxin OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=MTH_895 PE=1 SV=1
17	P31210	3.1	32.0	326	0.066	0.071	AK1D1_RAT Aldo-keto reductase family 1 member D1 OS=Rattus norvegicus OX=10116 GN=Akr1d1 PE=1 SV=1
18	F4IDQ6	4.2	32.0	1576	0.046	0.010	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
19	Q9JK71	4.4	32.0	1470	0.066	0.016	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
20	Q5TCQ9	4.9	32.0	1481	0.066	0.016	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04197 Birna_RdRp_palm	5.8e+02	10.7	Birnavirus RNA dependent RNA polymerase (VP1), palm domain
2	PF12802 MarR_2	1.5e+02	13.8	MarR family
3	PF14893 PNMA	1.4e-131	450.4	PNMA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349547	0.985	Ras association domain-containing protein 1
2	9606.ENSP00000162749	0.967	Tumor necrosis factor receptor superfamily member 1A
3	9606.ENSP00000340578	0.948	Ras association domain-containing protein 6
4	9606.ENSP00000221132	0.903	Tumor necrosis factor receptor superfamily member 10A
5	9606.ENSP00000261600	0.830	THO complex subunit 1
6	9606.ENSP00000407586	0.699	GTPase HRas
7	9606.ENSP00000318131	0.685	Paraneoplastic antigen-like protein 8A
8	9606.ENSP00000365844	0.680	E3 ubiquitin-protein ligase TRIM39
9	9606.ENSP00000318914	0.674	Paraneoplastic Ma antigens
10	9606.ENSP00000258149	0.668	E3 ubiquitin-protein ligase Mdm2
11	9606.ENSP00000328088	0.659	PRKC apoptosis WT1 regulator protein
12	9606.ENSP00000404658	0.640	Histone-lysine N-methyltransferase EZH1
13	9606.ENSP00000437550	0.624	Serine/threonine-protein kinase LATS1
14	9606.ENSP00000361725	0.608	Endonuclease G, mitochondrial
15	9606.ENSP00000301764	0.579	DNA damage-binding protein 1
16	9606.ENSP00000262506	0.547	Casein kinase II subunit alpha
17	9606.ENSP00000417207	0.520	Homeobox protein Hox-B3
18	9606.ENSP00000380713	0.507	Ras association domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.802	enzyme binding
GO:0031625	0.588	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0006915	0.978	apoptotic process
GO:0007165	0.976	signal transduction
GO:0009893	0.975	positive regulation of metabolic process
GO:0048522	0.974	positive regulation of cellular process
GO:0016043	0.972	cellular component organization
GO:0051641	0.971	cellular localization
GO:0031323	0.969	regulation of cellular metabolic process
GO:0035556	0.951	intracellular signal transduction
GO:0065008	0.948	regulation of biological quality
GO:0009896	0.946	positive regulation of catabolic process
GO:0010506	0.940	regulation of autophagy
GO:0031325	0.937	positive regulation of cellular metabolic process
GO:0044087	0.935	regulation of cellular component biogenesis
GO:0006996	0.935	organelle organization
GO:0031331	0.934	positive regulation of cellular catabolic process
GO:0033043	0.929	regulation of organelle organization
GO:0097190	0.927	apoptotic signaling pathway
GO:0010508	0.906	positive regulation of autophagy
GO:1902115	0.902	regulation of organelle assembly
GO:0010638	0.902	positive regulation of organelle organization
GO:0006974	0.895	cellular response to DNA damage stimulus
GO:0044089	0.895	positive regulation of cellular component biogenesis
GO:0016239	0.885	positive regulation of macroautophagy
GO:1902117	0.874	positive regulation of organelle assembly
GO:0007166	0.862	cell surface receptor signaling pathway
GO:2000785	0.861	regulation of autophagosome assembly
GO:0033036	0.836	macromolecule localization
GO:0061024	0.825	membrane organization
GO:0051234	0.813	establishment of localization
GO:0010821	0.811	regulation of mitochondrion organization
GO:0008104	0.779	protein localization
GO:0007005	0.778	mitochondrion organization
GO:0006839	0.774	mitochondrial transport
GO:0007006	0.727	mitochondrial membrane organization
GO:0072657	0.719	protein localization to membrane
GO:0097193	0.718	intrinsic apoptotic signaling pathway
GO:0090559	0.690	regulation of membrane permeability
GO:0008637	0.674	apoptotic mitochondrial changes
GO:0045184	0.664	establishment of protein localization
GO:0070585	0.639	protein localization to mitochondrion
GO:0051205	0.620	protein insertion into membrane
GO:0042981	0.613	regulation of apoptotic process
GO:0046902	0.567	regulation of mitochondrial membrane permeability
GO:0090199	0.518	regulation of release of cytochrome c from mitochondria
GO:0072655	0.490	establishment of protein localization to mitochondrion
GO:0008630	0.464	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0090151	0.455	establishment of protein localization to mitochondrial membrane
GO:0008625	0.445	extrinsic apoptotic signaling pathway via death domain receptors
GO:0060255	0.386	regulation of macromolecule metabolic process
GO:0080090	0.385	regulation of primary metabolic process
GO:0051171	0.364	regulation of nitrogen compound metabolic process
GO:0010822	0.319	positive regulation of mitochondrion organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0031090	0.984	organelle membrane
GO:0005739	0.976	mitochondrion
GO:0005634	0.974	nucleus
GO:0070013	0.955	intracellular organelle lumen
GO:0043228	0.938	non-membrane-bounded organelle
GO:0043232	0.927	intracellular non-membrane-bounded organelle
GO:0031981	0.915	nuclear lumen
GO:0098588	0.903	bounding membrane of organelle
GO:0005654	0.901	nucleoplasm
GO:0031975	0.858	envelope
GO:0031966	0.848	mitochondrial membrane
GO:0019867	0.757	outer membrane
GO:0005741	0.701	mitochondrial outer membrane
GO:0032991	0.582	protein-containing complex
GO:0012505	0.340	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]