StarFunc result for job id Q96BY6

User Input

>input (2186 residues)
MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQEKPRLLEPLDYETVIEEL
EKTYRNDPLQDLLFFPSDDFSAATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQW
HVVNYKYEQYSGDIRQLPRAEYKPEKLPSHSFEIDHEDADKDEDTTSHSSSKGGGGAGGT
GVFKSGWLYKGNFNSTVNNTVTVRSFKKRYFQLTQLPDNSYIMNFYKDEKISKEPKGCIF
LDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDEWIHTLNRILQISPEGPLQGR
RSTELTDLGLDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLF
SLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSNLQGCVTENENDPITNI
EPFFVSVALYDLRDSRKISADFHVDLNHAAVRQMLLGASVALENGNIDTITPRQSEEPHI
KGLPEEWLKFPKQAVFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKIL
KSNRQFCSKLGKYRMPFAWAVRSVFKDNQGNVDRDSRFSPLFRQESSKISTEDLVKLVSD
YRRADRISKMQTIPGSLDIAVDNVPLEHPNCVTSSFIPVKPFNMMAQTEPTVEVEEFVYD
STKYCRPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCIEFKNSDEESAKPLKCIYGKP
GGPLFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCDINAKANAKKK
EALETSVGYAWLPLMKHDQIASQEYNIPIATSLPPNYLSFQDSASGKHGGSDIKWVDGGK
PLFKVSTFVVSTVNTQDPHVNAFFQECQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMS
FLPIILNQLFKVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTRACKE
RTVHEELAKNVTGLLKSNDSTTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLPRPQRFP
ESYQNELDNLVMVLSDHVIWKYKDALEETRRANHSVARFLKRCFTFMDRGYVFKMVNNYI
SMFSSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPDPLTPSESTQELHASDMPE
YSVTNEFCRKHFLIGILLREVGFALQEDQDVRHLALAVLKNLMAKHSFDDRYREPRKQAQ
IASLYMPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDT
SFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEKSSEKTDNCEKIPRPLSLI
GSTLRFDKLDQAETRSLLMCFLHIMKTISYETLIAYWQRAPSPEVSDFFSILDVCLQNFR
YLGKRNIIRKIAAAFKFVQSTQNNGTLKGSNPSCQTSGLLSQWMHSTSSHEGHKQHRSQT
LPIIRGKNALSNPKLLQMLDNTMTSNSNEIDIVHHVDTEANIATEVCLTILDLLSLFTQT
HQRQLQQCDCQNSLMKRVFDTYMLFFQVNQSATALKHVFASLRLFVCKFPSAFFQGPADL
CGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQLIKAVSQLIAD
AGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEM
LVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYW
KVEKICTASLLSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQ
DTPYNENILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSY
LKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADK
FGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFE
TPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKV
SELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEI
FRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGV
DQTCTRVISKATPALPTVSISSSAEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AF47	0.688	0.721	0.000	2073	0.491	0.518	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
2	AFDB:M9PCG3	0.715	0.684	0.000	2298	0.363	0.346	M9PCG3.pdb.gz	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
3	AFDB:Q8BIK4	0.689	0.729	0.000	2055	0.509	0.542	Q8BIK4.pdb.gz	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
4	AFDB:Q8BZN6	0.795	0.807	0.000	2150	0.925	0.941	Q8BZN6.pdb.gz	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
5	AFDB:Q9BZ29	0.709	0.745	0.000	2069	0.520	0.549	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
6	AFDB:Q96HP0	0.625	0.663	1.468E-99	2047	0.270	0.288	Q96HP0.pdb.gz	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
7	AFDB:Q9VPI9	0.433	0.456	1.460E-97	2064	0.265	0.281	Q9VPI9.pdb.gz	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
8	AFDB:Q8C147	0.549	0.567	1.570E-97	2100	0.280	0.291	Q8C147.pdb.gz	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
9	AFDB:Q96N67	0.561	0.571	1.817E-97	2140	0.278	0.284	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
10	AFDB:Q86I66	0.486	0.469	4.646E-81	2284	0.223	0.213	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
11	PDB:6tgbA	0.171	0.249	1.744E-18	1450	0.077	0.116	6tgbA.pdb.gz
12	PDB:7mq8LM	0.058	0.059	6.024E-5	2005	0.066	0.072	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7t3pA	0.080	0.083	7.230E-5	2066	0.094	0.100	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	PDB:7t3qA	0.075	0.076	7.230E-5	2103	0.086	0.090	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
15	PDB:6uqkA	0.085	0.089	8.067E-5	2054	0.079	0.084	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
16	PDB:7r5jB0	0.087	0.100	1.004E-4	1748	0.058	0.072	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7t3uA	0.075	0.077	1.042E-4	2020	0.081	0.088	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7t3rA	0.082	0.083	1.447E-4	2130	0.091	0.094	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7mopA	0.118	0.108	1.556E-4	2445	0.068	0.061	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
20	PDB:7pgsN	0.076	0.087	1.556E-4	1787	0.068	0.083	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YD85	0.0	4491	2199	0.981	0.975	A0A2R8YD85_HUMAN Dedicator of cytokinesis 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=1
2	A2AF47	0.0	2110	2073	0.498	0.525	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1
3	M9PCG3	0.0	1319	2298	0.356	0.339	M9PCG3_DROME Zizimin, isoform K OS=Drosophila melanogaster OX=7227 GN=Ziz PE=1 SV=1
4	Q5JSL3	0.0	2120	2073	0.498	0.525	DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2
5	Q8BIK4	0.0	2238	2055	0.514	0.546	DOCK9_MOUSE Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2
6	Q8BZN6	0.0	4202	2187	0.938	0.937	DOC10_MOUSE Dedicator of cytokinesis protein 10 OS=Mus musculus OX=10090 GN=Dock10 PE=1 SV=4
7	Q96BY6	0.0	4578	2186	1.000	1.000	DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3
8	Q9BZ29	0.0	2270	2069	0.525	0.554	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
9	Q9VPI9	0.0	697	2064	0.227	0.240	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
10	Q8C147	2.29e-164	561	2100	0.175	0.182	DOCK8_MOUSE Dedicator of cytokinesis protein 8 OS=Mus musculus OX=10090 GN=Dock8 PE=1 SV=4
11	Q96N67	3.38e-162	555	2140	0.172	0.176	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
12	Q8R1A4	3.11e-161	552	2130	0.172	0.176	DOCK7_MOUSE Dedicator of cytokinesis protein 7 OS=Mus musculus OX=10090 GN=Dock7 PE=1 SV=3
13	Q8NF50	3.18e-160	549	2099	0.173	0.180	DOCK8_HUMAN Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8 PE=1 SV=3
14	Q96HP0	4.79e-150	518	2047	0.169	0.181	DOCK6_HUMAN Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3
15	K7ESB7	2.04e-149	516	2082	0.169	0.177	K7ESB7_HUMAN Dedicator of cytokinesis 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=2
16	Q86I66	3.77e-93	340	2284	0.103	0.099	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
17	Q54CA8	2.11e-70	266	2147	0.088	0.090	Q54CA8_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizB PE=3 SV=1
18	Q8SAB7	9.78e-46	185	1830	0.095	0.113	SPK1_ARATH Guanine nucleotide exchange factor SPIKE 1 OS=Arabidopsis thaliana OX=3702 GN=SPK1 PE=1 SV=1
19	Q8IZD9	2.91e-16	88.2	2030	0.040	0.043	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
20	Q8CIQ7	6.81e-16	87.0	2027	0.040	0.043	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	4.4e-41	152.3	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	1.4e-25	100.5	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	4e-30	115.1	DHR-2, Lobe C
4	PF14429 DOCK-C2	4.8e-48	175.0	C2 domain in Dock180 and Zizimin proteins
5	PF11878 DOCK_C-D_N	2.2e-33	126.5	Dedicator of cytokinesis C/D, N terminal
6	PF00169 PH	1.4e-09	49.8	PH domain
7	PF15410 PH_9	2.4e+02	13.3	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.992	Cell division control protein 42 homolog
2	9606.ENSP00000304283	0.851	Ras-related C3 botulinum toxin substrate 3
3	9606.ENSP00000311135	0.827	Probable ATP-dependent RNA helicase DHX37
4	9606.ENSP00000262415	0.766	ATP-dependent RNA helicase DHX8
5	9606.ENSP00000348461	0.725	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000267205	0.705	Rho-related GTP-binding protein RhoF
7	9606.ENSP00000357668	0.685	Disintegrin and metalloproteinase domain-containing protein 12
8	9606.ENSP00000316729	0.655	Rho-related GTP-binding protein RhoJ
9	9606.ENSP00000417003	0.623	Involved in skeletal muscle differentiation. May act as a scaffold protein for AKT1 during muscle differentiation.
10	9606.ENSP00000308576	0.590	Rho-related GTP-binding protein RhoD
11	9606.ENSP00000326846	0.560	Uncharacterized protein C14orf28
12	9606.ENSP00000238738	0.559	Rho-related GTP-binding protein RhoQ
13	9606.ENSP00000452885	0.538	Ubiquitin carboxyl-terminal hydrolase MINDY-2
14	9606.ENSP00000412461	0.521	Rho GTPase-activating protein 22
15	9606.ENSP00000249071	0.514	Ras-related C3 botulinum toxin substrate 2
16	9606.ENSP00000339467	0.509	Rho-related GTP-binding protein RhoG
17	9606.ENSP00000300651	0.504	Mediator of RNA polymerase II transcription subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.998	guanyl-nucleotide exchange factor activity
GO:0051020	0.977	GTPase binding
GO:0031267	0.923	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.970	cellular process
GO:0050896	0.931	response to stimulus
GO:0044093	0.878	positive regulation of molecular function
GO:0071840	0.871	cellular component organization or biogenesis
GO:0040012	0.871	regulation of locomotion
GO:0048856	0.842	anatomical structure development
GO:0032501	0.810	multicellular organismal process
GO:0051336	0.803	regulation of hydrolase activity
GO:0043087	0.776	regulation of GTPase activity
GO:0043085	0.767	positive regulation of catalytic activity
GO:0016043	0.719	cellular component organization
GO:0042113	0.702	B cell activation
GO:0030154	0.597	cell differentiation
GO:0002285	0.593	lymphocyte activation involved in immune response
GO:0048518	0.535	positive regulation of biological process
GO:0002312	0.533	B cell activation involved in immune response
GO:0030097	0.525	hemopoiesis
GO:0030334	0.507	regulation of cell migration
GO:0048522	0.457	positive regulation of cellular process
GO:0007275	0.429	multicellular organism development
GO:0051345	0.422	positive regulation of hydrolase activity
GO:0043547	0.406	positive regulation of GTPase activity
GO:0051716	0.331	cellular response to stimulus
GO:0048731	0.311	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.998	membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.992	nucleoplasm
GO:0016020	0.859	membrane
GO:0005576	0.547	extracellular region
GO:0031982	0.519	vesicle
GO:0065010	0.355	extracellular membrane-bounded organelle
GO:0070062	0.349	extracellular exosome
GO:0071944	0.347	cell periphery
GO:0005886	0.338	plasma membrane
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]