StarFunc result for job id Q96BY7

User Input

>input (2078 residues)
MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEIL
ESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRPATGSEPMYWSSF
MTSSMQLAKECLSQKLTDEQGEGSQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPE
NSKTGTALEIRIERTVYCDETADESSGINVHQPTAFAHKLLQLSGVSLFWDEFSASAKSS
PVCSTAPVETEPKLSPSWNPKIIYEPHPQLTRNLPEIAPSDPVQIGRLIGRLELSLTLKQ
NEVLPGAKLDVDGQIDSIHLLLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQ
EDEYRIQMELNRYYLRKDSLSVGVSSEQSFYETETARTPSSREEEVFFSMADMDMSHSLS
SLPPLGDPPNMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFLDHHKEQPVRGSTFPSNL
VHPTPLQKTSLPSRSVSVDESRPELIFRLAVGTFSISVLHIDPLSPPETSQNLNPLTPMA
VAFFTCIEKIDPARFSTEDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRYFST
DMSIGQMEFLECLFPTDFHSVPPHYTELLTFHSKEETGSHSPVCLQLHYKHSENRGPQGN
QARLSSVPHKAELQIKLNPVCCELDISIVDRLNSLLQPQKLATVEMMASHMYTSYNKHIS
LHKAFTEVFLDDSHSPANCRISVQVATPALNLSVRFPIPDLRSDQERGPWFKKSLQKEIL
YLAFTDLEFKTEFIGGSTPEQIKLELTFRELIGSFQEEKGDPSIKFFHVSSGVDGDTTSS
DDFDWPRIVLKINPPAMHSILERIAAEEEEENDGHYQEEEEGGAHSLKDVCDLRRPAPSP
FSSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELTLPNIYVTLPNKSFYEKLYNR
IFNDLLLWEPTAPSPVETFENISYGIGLSVASQLINTFNKDSFSAFKSAVHYDEESGSEE
ETLQYFSTVDPNYRSRRKKKLDSQNKNSQSFLSVLLNINHGLIAVFTDVKQDNGDLLENK
HGEFWLEFNSGSLFCVTKYEGFDDKHYICLHSSSFSLYHKGIVNGVILPTETRLPSSTRP
HWLEPTIYSSEEDGLSKTSSDGVGGDSLNMLSVAVKILSDKSESNTKEFLIAVGLKGATL
QHRMLPSGLSWHEQILYFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLYLPIRSLL
TVETFSVSSSVALDKSSSTLRIILDEAALHLSDKCNTVTINLSRDYVRVMDMGLLELTIT
AVKSDSDGEQTEPRFELHCSSDVVHIRTCSDSCAALMNLIQYIASYGDLQTPNKADMKPG
AFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEK
SQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAA
MQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLY
GGKDFGIVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGKGRNHDFLMEIQLSKVKFQHE
VYPPCKPDCDSSLSEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKEMPRKAHSNML
TVKALHVCPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEV
KKSPGADVTCSLPRHLSTSKEPNLVISFSGPKQPSQNDSANSVEVVNGMEEKNFSAEEAS
FRDQPVFFREFRFTSEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLSYRHG
LLGVDKLFSYAITEWLNDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGR
IVRGFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPGTLSIEPKKTKRFPHH
RLAHQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVV
KPLIVATEATSNVLGGMRNQIRPDVRQDESQKWRHGDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q21480	0.657	0.600	0.000	2290	0.217	0.197	Q21480.pdb.gz	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
2	AFDB:Q2TAZ0	0.708	0.756	0.000	1938	0.420	0.450	Q2TAZ0.pdb.gz	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
3	AFDB:Q96BY7	1.000	1.000	0.000	2078	1.000	1.000	Q96BY7.pdb.gz	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
4	AFDB:Q9VZX7	0.646	0.701	0.000	1906	0.268	0.292	Q9VZX7.pdb.gz	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
5	AFDB:F8S296	0.516	0.562	1.216E-86	1892	0.167	0.183	F8S296.pdb.gz	ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ATG2 PE=2 SV=1
6	AFDB:A0JNW5	0.223	0.304	1.829E-27	1464	0.089	0.126	A0JNW5.pdb.gz	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
7	PDB:6a9eA	0.071	0.358	6.752E-7	339	0.016	0.097	6a9eA.pdb.gz
8	PDB:6e4vA	0.036	0.072	5.403E-2	672	0.024	0.073	6e4vA.pdb.gz	Determination of the molecular basis for coprogen import by Gram-negative bacteria.
9	AFDB:Q9H5V8	0.042	0.077	6.209E-2	836	0.046	0.115	Q9H5V8.pdb.gz	CDCP1_HUMAN CUB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CDCP1 PE=1 SV=3
10	PDB:4o9yA	0.034	0.030	6.253E-2	2490	0.014	0.012	4o9yA.pdb.gz
11	AFDB:Q4AC94	0.048	0.045	7.185E-2	2353	0.088	0.077	Q4AC94.pdb.gz	C2CD3_HUMAN C2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=C2CD3 PE=1 SV=4
12	PDB:6i97A	0.047	0.092	7.975E-2	763	0.020	0.055	6i97A.pdb.gz	Ternary structure of the outer membrane transporter FoxA with resolved signalling domain provides insights into TonB-mediated siderophore uptake.
13	AFDB:P43146	0.025	0.034	1.227E-1	1447	0.044	0.063	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
14	AFDB:Q920G3	0.031	0.068	1.811E-1	569	0.019	0.069	Q920G3.pdb.gz	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
15	PDB:2o5pA	0.045	0.093	2.327E-1	772	0.022	0.060	2o5pA.pdb.gz
16	PDB:5cskB	0.042	0.043	3.115E-1	2017	0.020	0.020	5cskB.pdb.gz
17	PDB:5xdoB	0.027	0.102	3.434E-1	258	0.009	0.074	5xdoB.pdb.gz
18	PDB:3fyxA	0.035	0.108	3.785E-1	340	0.014	0.085	3fyxA.pdb.gz	On the function and structure of synthetically modified porins.
19	PDB:2gskA	0.037	0.096	5.068E-1	590	0.027	0.095	2gskA.pdb.gz	Outer membrane active transport: structure of the BtuB:TonB complex
20	PDB:2hdiA	0.040	0.097	5.068E-1	598	0.028	0.099	2hdiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TAZ0	0.0	1421	1938	0.423	0.454	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
2	Q80XK6	0.0	3922	2075	0.910	0.911	ATG2B_MOUSE Autophagy-related protein 2 homolog B OS=Mus musculus OX=10090 GN=Atg2b PE=1 SV=3
3	Q96BY7	0.0	4308	2078	1.000	1.000	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
4	Q9VZX7	8.58e-154	526	1906	0.207	0.226	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
5	Q2XXT6	7.68e-153	523	1873	0.205	0.227	Q2XXT6_DROME CG1241 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=3 SV=1
6	Q95TX2	4.36e-130	432	819	0.141	0.359	Q95TX2_DROME GH26553p OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
7	Q21480	1.11e-42	175	2290	0.046	0.042	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
8	F8S296	1.07e-32	142	1892	0.066	0.073	ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ATG2 PE=2 SV=1
9	O94649	2.02e-17	92.0	1646	0.031	0.039	ATG2_SCHPO Autophagy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg2 PE=1 SV=4
10	P53855	2.71e-14	81.6	1592	0.042	0.055	ATG2_YEAST Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG2 PE=1 SV=1
11	F4JNE2	1.94e-06	55.8	4219	0.025	0.012	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
12	Q9VU08	5.60e-06	54.3	3919	0.026	0.014	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
13	F4HWS2	1.28e-05	53.1	4146	0.024	0.012	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
14	P87319	6.87e-04	47.4	3011	0.033	0.023	VP13A_SCHPO Intermembrane lipid transfer protein vps1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps1301 PE=3 SV=2
15	A0A0D9RI63	0.001	47.0	3754	0.019	0.010	A0A0D9RI63_CHLSB Vacuolar protein sorting 13 homolog C OS=Chlorocebus sabaeus OX=60711 GN=VPS13C PE=3 SV=1
16	Q709C8	0.001	47.0	3753	0.019	0.010	VP13C_HUMAN Intermembrane lipid transfer protein VPS13C OS=Homo sapiens OX=9606 GN=VPS13C PE=1 SV=1
17	Q8BX70	0.001	47.0	3748	0.013	0.007	VP13C_MOUSE Intermembrane lipid transfer protein VPS13C OS=Mus musculus OX=10090 GN=Vps13c PE=1 SV=2
18	Q54KX3	0.002	46.2	4246	0.019	0.009	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
19	Q5THJ4	0.002	45.8	4388	0.025	0.012	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
20	G0S3B8	0.003	45.4	3225	0.023	0.015	VPS13_CHATD Intermembrane lipid transfer protein VPS13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=VPS13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13329 ATG2_CAD	0.75	21.0	Autophagy-related protein 2 CAD motif
2	PF09333 ATG_C	2.4e-25	99.9	Autophagy-related protein C terminal domain
3	PF12624 Chorein_N	9.1e-14	62.9	N-terminal region of Chorein or VPS13
4	PF16908 VPS13	7.1	17.8	Vacuolar sorting-associated protein 13, N-terminal
5	PF16909 VPS13_C	0.042	25.1	Vacuolar-sorting-associated 13 protein C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262139	0.986	WD repeat domain phosphoinositide-interacting protein 1
2	9606.ENSP00000348848	0.984	WD repeat domain phosphoinositide-interacting protein 4
3	9606.ENSP00000288828	0.981	WD repeat domain phosphoinositide-interacting protein 2
4	9606.ENSP00000378914	0.942	Serine/threonine-protein kinase ULK2
5	9606.ENSP00000324560	0.937	Serine/threonine-protein kinase ULK1
6	9606.ENSP00000386710	0.878	Autophagy-related protein 9A
7	9606.ENSP00000366475	0.860	Autophagy-related protein 2 homolog A
8	9606.ENSP00000358072	0.816	Autophagy protein 5
9	9606.ENSP00000322159	0.813	Cysteine protease ATG4C
10	9606.ENSP00000425107	0.804	Ubiquitin-like protein ATG12
11	9606.ENSP00000355231	0.790	Beclin-1
12	9606.ENSP00000311318	0.786	Cysteine protease ATG4D
13	9606.ENSP00000282185	0.777	Ubiquitin-like-conjugating enzyme ATG10
14	9606.ENSP00000346437	0.772	Ubiquitin-like modifier-activating enzyme ATG7
15	9606.ENSP00000361306	0.765	Cysteine protease ATG4A
16	9606.ENSP00000283290	0.764	Ubiquitin-like-conjugating enzyme ATG3
17	9606.ENSP00000432412	0.744	Autophagy-related protein 13
18	9606.ENSP00000451188	0.738	GSK3B-interacting protein
19	9606.ENSP00000262039	0.729	Phosphatidylinositol 3-kinase catalytic subunit type 3
20	9606.ENSP00000384259	0.727	Cysteine protease ATG4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0120013	1.000	lipid transfer activity
GO:0005515	0.986	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.987	cellular component organization or biogenesis
GO:0044237	0.987	cellular metabolic process
GO:0061919	0.986	process utilizing autophagic mechanism
GO:0050794	0.986	regulation of cellular process
GO:0016241	0.983	regulation of macroautophagy
GO:0016236	0.976	macroautophagy
GO:0016043	0.975	cellular component organization
GO:0006996	0.936	organelle organization
GO:0048518	0.916	positive regulation of biological process
GO:0016239	0.908	positive regulation of macroautophagy
GO:0010638	0.901	positive regulation of organelle organization
GO:0007033	0.772	vacuole organization
GO:0000045	0.742	autophagosome assembly
GO:0071704	0.488	organic substance metabolic process
GO:0050896	0.485	response to stimulus
GO:0044238	0.453	primary metabolic process
GO:0043170	0.413	macromolecule metabolic process
GO:1902115	0.360	regulation of organelle assembly
GO:0044089	0.324	positive regulation of cellular component biogenesis
GO:2000785	0.316	regulation of autophagosome assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0012505	0.968	endomembrane system
GO:0005829	0.924	cytosol
GO:0031982	0.918	vesicle
GO:0016020	0.867	membrane
GO:0097708	0.781	intracellular vesicle
GO:0044232	0.771	organelle membrane contact site
GO:0031410	0.715	cytoplasmic vesicle
GO:0005768	0.453	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]