StarFunc result for job id Q96BZ9

User Input

>input (403 residues)
MALRSAQGDGPTSGHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGL
LTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQRE
GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDP
TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD
FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV
QFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLRPEDRTKDVLT
KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BZ9	1.000	1.000	4.854E-55	403	1.000	1.000	Q96BZ9.pdb.gz	TBC20_HUMAN TBC1 domain family member 20 OS=Homo sapiens OX=9606 GN=TBC1D20 PE=1 SV=1
2	AFDB:Q9W5H8	0.718	0.764	1.428E-24	378	0.350	0.373	Q9W5H8.pdb.gz	Q9W5H8_DROME RE60063p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17883 PE=2 SV=1
3	AFDB:O94661	0.647	0.697	1.698E-16	373	0.238	0.257	O94661.pdb.gz	GYP10_SCHPO GTPase-activating protein gyp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp10 PE=4 SV=1
4	AFDB:P43570	0.584	0.480	1.200E-11	497	0.221	0.179	P43570.pdb.gz	GYP8_YEAST GTPase-activating protein GYP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GYP8 PE=1 SV=1
5	AFDB:Q4GYQ1	0.526	0.403	3.445E-11	533	0.189	0.143	Q4GYQ1.pdb.gz	Q4GYQ1_TRYB2 GTPase activating protein of Rab-like GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3220 PE=4 SV=1
6	AFDB:Q96CN4	0.602	0.321	2.054E-9	794	0.169	0.086	Q96CN4.pdb.gz	EVI5L_HUMAN EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1
7	AFDB:S6F527	0.576	0.281	9.998E-9	888	0.171	0.078	S6F527.pdb.gz	EAT17_CAEEL Rab GTPase-activating protein eat-17 OS=Caenorhabditis elegans OX=6239 GN=eat-17 PE=1 SV=1
8	AFDB:O60447	0.579	0.301	1.246E-8	810	0.171	0.085	O60447.pdb.gz	EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3
9	AFDB:Q6AWQ6	0.515	0.397	1.850E-8	535	0.181	0.136	Q6AWQ6.pdb.gz	Q6AWQ6_DROME RH06321p (Fragment) OS=Drosophila melanogaster OX=7227 GN=plx PE=2 SV=1
10	AFDB:Q8WUA7	0.577	0.459	3.000E-8	517	0.139	0.108	Q8WUA7.pdb.gz	TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A PE=1 SV=2
11	PDB:4z6yA	0.437	0.618	3.581E-4	273	0.102	0.150	4z6yA.pdb.gz
12	PDB:3bnfA	0.080	0.074	5.771E-1	471	0.079	0.068	3bnfA.pdb.gz	Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase
13	PDB:6m58B	0.121	0.103	6.031E-1	550	0.129	0.095	6m58B.pdb.gz
14	PDB:1hm6A	0.104	0.114	7.513E-1	343	0.089	0.105	1hm6A.pdb.gz
15	PDB:7zs9M	0.123	0.150	1.022	310	0.117	0.152	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:7dxbA	0.097	0.064	1.273	738	0.107	0.058	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
17	PDB:1ainA	0.096	0.108	1.390	314	0.084	0.108	1ainA.pdb.gz
18	PDB:4rp9A	0.088	0.082	1.453	451	0.089	0.080	4rp9A.pdb.gz	Crystal structure of a phosphorylation-coupled vitamin C transporter.
19	PDB:7vgfA	0.091	0.075	1.518	550	0.104	0.076	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
20	PDB:5yqzR	0.130	0.099	1.810	558	0.094	0.068	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BZ9	0.0	832	403	1.000	1.000	TBC20_HUMAN TBC1 domain family member 20 OS=Homo sapiens OX=9606 GN=TBC1D20 PE=1 SV=1
2	Q9D9I4	0.0	721	402	0.931	0.933	TBC20_MOUSE TBC1 domain family member 20 OS=Mus musculus OX=10090 GN=Tbc1d20 PE=1 SV=1
3	Q9W5H8	2.45e-82	258	378	0.328	0.349	Q9W5H8_DROME RE60063p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17883 PE=2 SV=1
4	A0A0B4KEC2	7.41e-81	254	376	0.328	0.351	A0A0B4KEC2_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG40289 PE=4 SV=1
5	Q5LJQ4	2.35e-77	243	282	0.305	0.436	Q5LJQ4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17883 PE=4 SV=1
6	A0A0B4KEH8	1.36e-76	243	371	0.315	0.342	A0A0B4KEH8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG40289 PE=4 SV=1
7	O94661	5.09e-36	137	373	0.211	0.228	GYP10_SCHPO GTPase-activating protein gyp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp10 PE=4 SV=1
8	Q4GYQ1	9.92e-18	87.4	533	0.127	0.096	Q4GYQ1_TRYB2 GTPase activating protein of Rab-like GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3220 PE=4 SV=1
9	P43570	9.13e-14	75.1	497	0.159	0.129	GYP8_YEAST GTPase-activating protein GYP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GYP8 PE=1 SV=1
10	Q95RC5	2.78e-05	48.5	546	0.127	0.093	Q95RC5_DROME LD44506p OS=Drosophila melanogaster OX=7227 GN=Tbc1d22 PE=2 SV=1
11	Q9VYY9	3.51e-04	45.1	807	0.107	0.053	EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3
12	Q6ZT07	8.31e-04	44.3	1266	0.114	0.036	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
13	P53258	0.002	42.7	950	0.124	0.053	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
14	Q9UPU7	0.002	42.7	963	0.094	0.039	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
15	Q9NU19	0.006	41.2	505	0.124	0.099	TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens OX=9606 GN=TBC1D22B PE=1 SV=3
16	Q8TEA7	0.009	40.8	893	0.104	0.047	TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK PE=1 SV=4
17	Q66K14	0.025	39.3	1250	0.094	0.030	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
18	A1L3A9	0.027	39.3	1232	0.094	0.031	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
19	Q8IYX1	0.036	38.5	336	0.129	0.155	TBC21_HUMAN TBC1 domain family member 21 OS=Homo sapiens OX=9606 GN=TBC1D21 PE=1 SV=1
20	Q6DHY5	0.058	38.1	549	0.134	0.098	TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens OX=9606 GN=TBC1D3G PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18053 GyrB_insert	1.9e+02	13.4	DNA gyrase B subunit insert domain
2	PF00566 RabGAP-TBC	2.5e-26	104.2	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310226	0.984	Ras-related protein Rab-1B
2	9606.ENSP00000387286	0.901	Ras-related protein Rab-1A
3	9606.ENSP00000460380	0.806	Ubiquitin carboxyl-terminal hydrolase 6
4	9606.ENSP00000353549	0.798	Cell division cycle protein 16 homolog
5	9606.ENSP00000377700	0.795	TBC1 domain family member 23
6	9606.ENSP00000262646	0.765	Ras-related protein Rab-2A
7	9606.ENSP00000411418	0.764	Rab3 GTPase-activating protein catalytic subunit
8	9606.ENSP00000351832	0.748	Rab3 GTPase-activating protein non-catalytic subunit
9	9606.ENSP00000362751	0.722	Rab GTPase-activating protein 1
10	9606.ENSP00000478479	0.714	Ras-related protein Rab-18
11	9606.ENSP00000271688	0.705	Ceramide synthase 2
12	9606.ENSP00000448182	0.685	TBC1 domain family member 15
13	9606.ENSP00000349291	0.672	TBC1 domain family member 9B
14	9606.ENSP00000248929	0.664	Small G protein signaling modulator 3
15	9606.ENSP00000251588	0.655	Cytosolic Fe-S cluster assembly factor NARFL
16	9606.ENSP00000449500	0.653	Ribonuclease kappa
17	9606.ENSP00000362590	0.651	TBC1 domain family member 22B
18	9606.ENSP00000221543	0.649	TBC1 domain family member 17
19	9606.ENSP00000247461	0.622	Calnexin
20	9606.ENSP00000402935	0.614	TBC1 domain family member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.987	cellular component organization
GO:0010256	0.974	endomembrane system organization
GO:0051179	0.968	localization
GO:0065007	0.965	biological regulation
GO:0006810	0.938	transport
GO:0006996	0.938	organelle organization
GO:0050789	0.927	regulation of biological process
GO:0016192	0.890	vesicle-mediated transport
GO:0050794	0.881	regulation of cellular process
GO:0046907	0.856	intracellular transport
GO:0007030	0.545	Golgi organization
GO:0048518	0.522	positive regulation of biological process
GO:0048522	0.507	positive regulation of cellular process
GO:0016050	0.496	vesicle organization
GO:0032879	0.367	regulation of localization
GO:0065009	0.319	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005783	0.997	endoplasmic reticulum
GO:0031090	0.989	organelle membrane
GO:0005634	0.988	nucleus
GO:0031984	0.979	organelle subcompartment
GO:0005794	0.928	Golgi apparatus
GO:0031982	0.919	vesicle
GO:0098588	0.899	bounding membrane of organelle
GO:0042175	0.827	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005793	0.782	endoplasmic reticulum-Golgi intermediate compartment
GO:0005789	0.775	endoplasmic reticulum membrane
GO:0031975	0.774	envelope
GO:0000139	0.610	Golgi membrane
GO:0005829	0.496	cytosol
GO:0031967	0.414	organelle envelope
GO:0005635	0.375	nuclear envelope
GO:0033116	0.365	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0031965	0.334	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]