StarFunc result for job id Q96C03

User Input

>input (454 residues)
MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDE
DDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSP
APLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGG
PLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPW
DRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELT
VAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLL
CAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCH
FNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96C03	1.000	1.000	4.036E-78	454	1.000	1.000	Q96C03.pdb.gz	MID49_HUMAN Mitochondrial dynamics protein MID49 OS=Homo sapiens OX=9606 GN=MIEF2 PE=1 SV=1
2	AFDB:Q5NCS9	0.741	0.741	2.717E-63	454	0.797	0.797	Q5NCS9.pdb.gz	MID49_MOUSE Mitochondrial dynamics protein MID49 OS=Mus musculus OX=10090 GN=Mief2 PE=1 SV=1
3	AFDB:Q5XIS8	0.728	0.714	5.555E-41	463	0.452	0.443	Q5XIS8.pdb.gz	MID51_RAT Mitochondrial dynamics protein MID51 OS=Rattus norvegicus OX=10116 GN=Mief1 PE=1 SV=1
4	AFDB:A7SFB5	0.598	0.640	2.210E-20	422	0.187	0.201	A7SFB5.pdb.gz	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
5	AFDB:Q8C6L5	0.582	0.525	2.586E-14	507	0.143	0.128	Q8C6L5.pdb.gz	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
6	AFDB:F1QCP4	0.602	0.468	4.148E-14	592	0.167	0.128	F1QCP4.pdb.gz	F1QCP4_DANRE Cyclic GMP-AMP synthase OS=Danio rerio OX=7955 GN=mb21d1 PE=3 SV=2
7	AFDB:Q8N884	0.556	0.490	1.542E-13	522	0.165	0.144	Q8N884.pdb.gz	CGAS_HUMAN Cyclic GMP-AMP synthase OS=Homo sapiens OX=9606 GN=CGAS PE=1 SV=2
8	PDB:5eomC	0.510	0.633	1.495E-12	353	0.132	0.170	5eomC.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
9	PDB:7lt2A	0.532	0.614	1.944E-12	387	0.121	0.142	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
10	PDB:5eogF	0.473	0.624	6.226E-11	330	0.119	0.164	5eogF.pdb.gz
11	PDB:7buqA	0.543	0.665	4.830E-10	362	0.117	0.146	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
12	PDB:7lt1A	0.466	0.518	5.703E-9	403	0.121	0.136	7lt1A.pdb.gz
13	PDB:5eomJ	0.420	0.632	9.309E-7	286	0.110	0.175	5eomJ.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
14	PDB:4atbA	0.424	0.548	1.429E-5	334	0.101	0.138	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
15	PDB:4xj6A	0.354	0.418	2.547E-5	370	0.110	0.135	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
16	PDB:4rwnA	0.411	0.517	7.676E-5	349	0.093	0.120	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
17	PDB:4txzB	0.338	0.402	8.987E-5	366	0.090	0.112	4txzB.pdb.gz	Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
18	AFDB:Q8VI93	0.383	0.175	1.282E-4	1138	0.132	0.053	Q8VI93.pdb.gz	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
19	AFDB:Q585X9	0.321	0.293	4.107E-3	511	0.134	0.119	Q585X9.pdb.gz	Q585X9_TRYB2 PAP-associated domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.660 PE=4 SV=1
20	AFDB:O84876	0.076	0.082	7.848E-1	418	0.097	0.105	O84876.pdb.gz	CDUB1_CHLTR Deubiquitinase and deneddylase Dub1 OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=cdu1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5NCS9	0.0	674	454	0.797	0.797	MID49_MOUSE Mitochondrial dynamics protein MID49 OS=Mus musculus OX=10090 GN=Mief2 PE=1 SV=1
2	Q96C03	0.0	892	454	1.000	1.000	MID49_HUMAN Mitochondrial dynamics protein MID49 OS=Homo sapiens OX=9606 GN=MIEF2 PE=1 SV=1
3	Q8BGV8	1.27e-119	359	463	0.467	0.458	MID51_MOUSE Mitochondrial dynamics protein MID51 OS=Mus musculus OX=10090 GN=Mief1 PE=1 SV=1
4	Q5XIS8	1.29e-119	359	463	0.469	0.460	MID51_RAT Mitochondrial dynamics protein MID51 OS=Rattus norvegicus OX=10116 GN=Mief1 PE=1 SV=1
5	Q9NQG6	4.50e-119	357	463	0.471	0.462	MID51_HUMAN Mitochondrial dynamics protein MIEF1 OS=Homo sapiens OX=9606 GN=MIEF1 PE=1 SV=1
6	A7SFB5	1.98e-06	52.4	422	0.079	0.085	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
7	Q9LV85	1.1	34.3	564	0.044	0.035	CPR5_ARATH Protein CPR-5 OS=Arabidopsis thaliana OX=3702 GN=CPR5 PE=1 SV=1
8	Q8UUZ1	4.2	32.0	359	0.042	0.053	MB212_DANRE Protein mab-21-like 2 OS=Danio rerio OX=7955 GN=mab21l2 PE=1 SV=1
9	Q9Y586	4.2	32.0	359	0.042	0.053	MB212_HUMAN Protein mab-21-like 2 OS=Homo sapiens OX=9606 GN=MAB21L2 PE=1 SV=1
10	Q2TA14	4.3	32.3	499	0.035	0.032	PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus OX=9913 GN=PRCP PE=2 SV=1
11	Q7TMR0	5.2	32.0	491	0.037	0.035	PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus OX=10090 GN=Prcp PE=1 SV=2
12	Q9I3G2	5.3	31.6	308	0.033	0.049	Q9I3G2_PSEAE Cbb3-type cytochrome c oxidase subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ccoP2 PE=3 SV=1
13	Q8BPP1	5.9	31.6	359	0.042	0.053	MB212_MOUSE Protein mab-21-like 2 OS=Mus musculus OX=10090 GN=Mab21l2 PE=2 SV=1
14	B7Z7Q6	8.5	31.2	391	0.031	0.036	B7Z7Q6_HUMAN Prolylcarboxypeptidase OS=Homo sapiens OX=9606 GN=PRCP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20266 Mab-21_C	0.00033	32.1	Mab-21 protein HhH/H2TH-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000449089	0.994	Dynamin-1-like protein
2	9606.ENSP00000223136	0.921	Mitochondrial fission 1 protein
3	9606.ENSP00000302037	0.910	Mitochondrial fission factor
4	9606.ENSP00000296805	0.902	Ribosome-releasing factor 2, mitochondrial
5	9606.ENSP00000420617	0.855	Mitofusin-1
6	9606.ENSP00000280557	0.803	Density-regulated protein
7	9606.ENSP00000235329	0.781	Mitofusin-2
8	9606.ENSP00000419038	0.770	Elongation factor G, mitochondrial
9	9606.ENSP00000343867	0.720	Ribosome-recycling factor, mitochondrial
10	9606.ENSP00000362014	0.681	Dynamin-1
11	9606.ENSP00000354681	0.655	Dynamin-like 120 kDa protein, mitochondrial
12	9606.ENSP00000351813	0.654	E3 ubiquitin-protein ligase MARCH5
13	9606.ENSP00000370849	0.649	Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2
14	9606.ENSP00000355566	0.645	Mitochondrial import receptor subunit TOM20 homolog
15	9606.ENSP00000313877	0.640	Elongation factor Ts, mitochondrial
16	9606.ENSP00000297990	0.626	Nucleolar protein 6
17	9606.ENSP00000376246	0.626	Protein MB21D2
18	9606.ENSP00000358794	0.615	Monocarboxylate transporter 5
19	9606.ENSP00000360270	0.615	Metalloendopeptidase OMA1, mitochondrial
20	9606.ENSP00000322439	0.602	Elongation factor Tu, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0033043	0.995	regulation of organelle organization
GO:0090140	0.994	regulation of mitochondrial fission
GO:0009987	0.992	cellular process
GO:0010822	0.986	positive regulation of mitochondrion organization
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.962	cellular component organization
GO:0051094	0.948	positive regulation of developmental process
GO:0007005	0.782	mitochondrion organization
GO:0032879	0.778	regulation of localization
GO:0060341	0.764	regulation of cellular localization
GO:0032880	0.702	regulation of protein localization
GO:0051049	0.561	regulation of transport
GO:1903829	0.506	positive regulation of protein localization
GO:0051223	0.502	regulation of protein transport
GO:1904951	0.490	positive regulation of establishment of protein localization
GO:1903533	0.489	regulation of protein targeting
GO:0051222	0.480	positive regulation of protein transport
GO:1905475	0.382	regulation of protein localization to membrane
GO:0090141	0.375	positive regulation of mitochondrial fission
GO:0090316	0.351	positive regulation of intracellular protein transport
GO:0061024	0.322	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005741	0.998	mitochondrial outer membrane
GO:0032991	0.693	protein-containing complex
GO:0070013	0.522	intracellular organelle lumen
GO:0005829	0.381	cytosol
GO:0031981	0.372	nuclear lumen
GO:0012505	0.346	endomembrane system
GO:0005654	0.322	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]