StarFunc result for job id Q96C10

User Input

>input (678 residues)
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96C10	1.000	1.000	0.000	678	1.000	1.000	Q96C10.pdb.gz	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
2	AFDB:Q99J87	0.992	0.992	0.000	678	0.786	0.786	Q99J87.pdb.gz	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
3	AFDB:A0A060Y3B2	0.966	0.966	5.666E-81	678	0.482	0.482	A0A060Y3B2.pdb.gz	A0A060Y3B2_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00027343001 PE=3 SV=1
4	AFDB:Q9BYX4	0.904	0.607	1.357E-71	1025	0.425	0.281	Q9BYX4.pdb.gz	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
5	AFDB:A7LCX1	0.916	0.616	1.058E-70	1023	0.429	0.284	A7LCX1.pdb.gz	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
6	AFDB:Q8R5F7	0.897	0.604	9.816E-69	1025	0.416	0.275	Q8R5F7.pdb.gz	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
7	AFDB:D7F7W8	0.900	0.620	5.296E-68	1002	0.414	0.280	D7F7W8.pdb.gz	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
8	AFDB:A0A0E3D804	0.908	0.627	7.658E-68	997	0.413	0.281	A0A0E3D804.pdb.gz	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
9	AFDB:A0A060VZM9	0.906	0.610	4.591E-67	1026	0.413	0.273	A0A060VZM9.pdb.gz	A0A060VZM9_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00074546001 PE=3 SV=1
10	PDB:7bkpA	0.851	0.839	2.813E-62	689	0.412	0.405	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
11	PDB:6h61A	0.850	0.871	3.080E-56	660	0.412	0.423	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
12	AFDB:A0A0E3D807	0.884	0.625	1.035E-54	973	0.329	0.229	A0A0E3D807.pdb.gz
13	PDB:8dvsA	0.871	0.866	5.927E-51	682	0.307	0.305	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
14	PDB:7tnxA	0.796	0.831	7.263E-41	647	0.285	0.298	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:4a2wA	0.448	0.448	4.354E-33	678	0.233	0.233	4a2wA.pdb.gz
16	PDB:7w0dA	0.545	0.258	4.875E-22	1544	0.164	0.072	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
17	PDB:7v6bA	0.411	0.217	8.702E-22	1496	0.155	0.070	7v6bA.pdb.gz
18	PDB:7v6cA	0.411	0.211	1.019E-21	1540	0.161	0.071	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
19	PDB:7w0bA	0.428	0.214	2.773E-21	1586	0.159	0.068	7w0bA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
20	PDB:7yymA	0.386	0.233	1.150E-20	1281	0.193	0.102	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060Y3B2	0.0	631	678	0.482	0.482	A0A060Y3B2_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00027343001 PE=3 SV=1
2	D7F7W9	0.0	629	677	0.481	0.482	D7F7W9_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
3	D7F7X0	0.0	574	623	0.448	0.488	D7F7X0_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
4	Q96C10	0.0	1410	678	1.000	1.000	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
5	Q99J87	0.0	1103	678	0.786	0.786	DHX58_MOUSE ATP-dependent RNA helicase DHX58 OS=Mus musculus OX=10090 GN=Dhx58 PE=1 SV=2
6	Q9BYX4	2.95e-175	528	1025	0.432	0.286	IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IFIH1 PE=1 SV=3
7	A7LCX1	5.88e-173	523	1023	0.434	0.287	A7LCX1_PIG RNA helicase OS=Sus scrofa OX=9823 GN=MDA5 PE=1 SV=1
8	Q8R5F7	1.01e-172	522	1025	0.432	0.286	IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ifih1 PE=1 SV=1
9	D7F7W8	3.94e-166	504	1002	0.422	0.285	D7F7W8_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=mda5 PE=2 SV=1
10	A0A0E3D804	2.31e-164	499	997	0.419	0.285	A0A0E3D804_DANRE RNA helicase OS=Danio rerio OX=7955 GN=MDA5a PE=2 SV=1
11	A0A060VZM9	2.73e-160	490	1026	0.423	0.280	A0A060VZM9_ONCMY RNA helicase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00074546001 PE=3 SV=1
12	A0A0D5W690	3.43e-99	327	937	0.339	0.245	A0A0D5W690_DANRE RNA helicase OS=Danio rerio OX=7955 GN=rigi PE=2 SV=1
13	O95786	1.19e-95	317	925	0.330	0.242	RIGI_HUMAN Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=RIGI PE=1 SV=2
14	C7C1L7	7.33e-95	316	962	0.333	0.235	C7C1L7_SALSA RNA helicase OS=Salmo salar OX=8030 GN=rig-I PE=2 SV=1
15	D3TI84	6.96e-94	313	933	0.317	0.230	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
16	Q6Q899	2.04e-92	308	926	0.316	0.231	RIGI_MOUSE Antiviral innate immune response receptor RIG-I OS=Mus musculus OX=10090 GN=Rigi PE=1 SV=2
17	Q93413	2.74e-47	182	1119	0.258	0.156	Q93413_CAEEL Helicase ATP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=drh-3 PE=1 SV=3
18	Q8TZH8	4.27e-31	132	764	0.208	0.185	Q8TZH8_PYRFU ATP-dependent RNA helicase, putative OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF2015 PE=1 SV=1
19	Q86L44	8.40e-27	119	837	0.189	0.153	Q86L44_DICDI RNA helicase OS=Dictyostelium discoideum OX=44689 GN=helF PE=4 SV=1
20	G5EDI8	4.26e-26	117	1037	0.140	0.092	G5EDI8_CAEEL Dicer-related helicase OS=Caenorhabditis elegans OX=6239 GN=drh-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	0.14	23.8	AAA domain
2	PF00270 DEAD	3.3e-12	58.0	DEAD/DEAH box helicase
3	PF00271 Helicase_C	8.5e-17	72.9	Helicase conserved C-terminal domain
4	PF04851 ResIII	4.9e-15	67.4	Type III restriction enzyme, res subunit
5	PF18119 RIG-I_C	1.9e-28	110.7	RIG-I receptor C-terminal domain
6	PF11648 RIG-I_C-RD	7.2e-33	124.7	C-terminal domain of RIG-I
7	PF18766 SWI2_SNF2	7.8e-05	34.0	SWI2/SNF2 ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401980	0.985	Mitochondrial antiviral-signaling protein
2	9606.ENSP00000369213	0.958	Probable ATP-dependent RNA helicase DDX58
3	9606.ENSP00000371471	0.929	Radical S-adenosyl methionine domain-containing protein 2
4	9606.ENSP00000368699	0.928	Ubiquitin-like protein ISG15
5	9606.ENSP00000263642	0.917	Interferon-induced helicase C domain-containing protein 1
6	9606.ENSP00000380697	0.916	Interferon regulatory factor 7
7	9606.ENSP00000381601	0.882	Interferon-induced GTP-binding protein Mx1
8	9606.ENSP00000215794	0.865	Ubl carboxyl-terminal hydrolase 18
9	9606.ENSP00000257570	0.843	2'-5'-oligoadenylate synthase-like protein
10	9606.ENSP00000259030	0.820	Receptor-transporting protein 4
11	9606.ENSP00000326247	0.812	Sterile alpha motif domain-containing protein 9-like
12	9606.ENSP00000359783	0.799	Interferon-induced protein 44
13	9606.ENSP00000296795	0.798	Toll-like receptor 3
14	9606.ENSP00000377344	0.797	Probable ATP-dependent RNA helicase DDX60
15	9606.ENSP00000323889	0.795	E3 ubiquitin/ISG15 ligase TRIM25
16	9606.ENSP00000360883	0.791	Interferon-induced protein with tetratricopeptide repeats 3
17	9606.ENSP00000342278	0.790	2'-5'-oligoadenylate synthase 2
18	9606.ENSP00000333266	0.781	Ubiquitin-like modifier-activating enzyme 7
19	9606.ENSP00000333657	0.776	Interferon-induced GTP-binding protein Mx2
20	9606.ENSP00000360869	0.765	Interferon-induced protein with tetratricopeptide repeats 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0003725	0.991	double-stranded RNA binding
GO:0005515	0.989	protein binding
GO:0003824	0.978	catalytic activity
GO:0008270	0.895	zinc ion binding
GO:0008186	0.872	ATP-dependent activity, acting on RNA
GO:0140640	0.779	catalytic activity, acting on a nucleic acid
GO:0140098	0.688	catalytic activity, acting on RNA
GO:0004386	0.688	helicase activity
GO:0016787	0.628	hydrolase activity
GO:0016887	0.609	ATP hydrolysis activity
GO:0003727	0.595	single-stranded RNA binding
GO:0003724	0.537	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.996	positive regulation of biological process
GO:0010468	0.995	regulation of gene expression
GO:0039531	0.995	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0050896	0.994	response to stimulus
GO:0002683	0.992	negative regulation of immune system process
GO:0031348	0.992	negative regulation of defense response
GO:0032102	0.991	negative regulation of response to external stimulus
GO:0002832	0.991	negative regulation of response to biotic stimulus
GO:0032103	0.987	positive regulation of response to external stimulus
GO:0032479	0.987	regulation of type I interferon production
GO:0002833	0.986	positive regulation of response to biotic stimulus
GO:0002376	0.985	immune system process
GO:0045089	0.984	positive regulation of innate immune response
GO:0050688	0.976	regulation of defense response to virus
GO:0050687	0.963	negative regulation of defense response to virus
GO:0009987	0.962	cellular process
GO:0001818	0.961	negative regulation of cytokine production
GO:0051716	0.952	cellular response to stimulus
GO:0032480	0.946	negative regulation of type I interferon production
GO:0050777	0.920	negative regulation of immune response
GO:0045824	0.904	negative regulation of innate immune response
GO:0048523	0.867	negative regulation of cellular process
GO:0023057	0.858	negative regulation of signaling
GO:0009968	0.848	negative regulation of signal transduction
GO:0002253	0.835	activation of immune response
GO:0007154	0.822	cell communication
GO:0007165	0.808	signal transduction
GO:0009607	0.804	response to biotic stimulus
GO:0002218	0.792	activation of innate immune response
GO:0044419	0.791	biological process involved in interspecies interaction between organisms
GO:0009605	0.789	response to external stimulus
GO:0002764	0.783	immune response-regulating signaling pathway
GO:0030522	0.761	intracellular receptor signaling pathway
GO:0051707	0.756	response to other organism
GO:0002757	0.755	immune response-activating signaling pathway
GO:0006950	0.749	response to stress
GO:0002758	0.716	innate immune response-activating signaling pathway
GO:0048522	0.713	positive regulation of cellular process
GO:0002221	0.672	pattern recognition receptor signaling pathway
GO:0010604	0.485	positive regulation of macromolecule metabolic process
GO:0051171	0.468	regulation of nitrogen compound metabolic process
GO:0080090	0.466	regulation of primary metabolic process
GO:0009615	0.421	response to virus
GO:0001819	0.421	positive regulation of cytokine production
GO:0031323	0.391	regulation of cellular metabolic process
GO:0008152	0.385	metabolic process
GO:0071704	0.378	organic substance metabolic process
GO:0042221	0.364	response to chemical
GO:0098542	0.358	defense response to other organism
GO:0009967	0.320	positive regulation of signal transduction
GO:0010033	0.314	response to organic substance
GO:0019219	0.312	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.405	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.628	Hydrolases.
RHEA:13065	0.609	ATP + H2O = ADP + H(+) + phosphate
EC:3.6.4.13	0.537	RNA helicase.

[back to server]