StarFunc result for job id Q96C45

User Input

>input (1275 residues)
MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVT
FHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFC
DISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVK
GSPVYTAPEVVRGADFSISSDLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPI
PKDSSRPKASSDFINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQESSVEDLSLSR
NTMECSGPQDSKELLQNSQSRQAKGHKSGQPLGHSFRLENPTEFRPKSTLEGQLNESMFL
LSSRPTPRTSTAVEVSPGEDMTHCSPQKTSPLTKITSGHLSQQDLESQMRELIYTDSDLV
VTPIIDNPKIMKQPPVKFDAKILHLPTYSVDKLLFLKDQDWNDFLQQVCSQIDSTEKSMG
ASRAKLNLLCYLCVVAGHQEVATRLLHSPLFQLLIQHLRIAPNWDIRAKVAHVIGLLASH
TAELQENTPVVEAIVLLTELIRENFRNSKLKQCLLPTLGELIYLVATQEEKKKNPRECWA
VPLAAYTVLMRCLREGEERVVNHMAAKIIENVCTTFSAQSQGFITGEIGPILWYLFRHST
ADSLRITAVSALCRITRHSPTAFQNVIEKVGLNSVINSLASAICKVQQYMLTLFAAMLSC
GIHLQRLIQEKGFVSTIIRLLDSPSTCIRAKAFLVLLYILIYNREMLLLSCQARLVMYIE
RDSRKTTPGKEQQSGNEYLSKCLDLLICHIVQELPRILGDILNSLANVSGRKHPSTVQVK
QLKLCLPLMPVVLHLVTSQVFRPQVVTEEFLFSYGTILSHIKSVDSGETNIDGAIGLTAS
EEFIKITLSAFEAIIQYPILLKDYRSTVVDYILPPLVSLVQSQNVEWRLFSLRLLSETTS
LLVNQEFGDGKEKASVDSDSNLLALIRDVLLPQYEHILLEPDPVPAYALKLLVAMTEHNP
TFTRLVEESKLIPLIFEVTLEHQESILGNTMQSVIALLSNLVACKDSNMELLYEQGLVSH
ICNLLTETATLCLDVDNKNNNEMAAPLLFSLLDILHSMLTYTSGIVRLALQAQKSGSGED
PQAAEDLLLLNRPLTDLISLLIPLLPNEDPEIFDVSSKCLSILVQLYGGENPDSLSPENV
EIFAHLLTSKEDPKEQKLLLRILRRMITSNEKHLESLKNAGSLLRALERLAPGSGSFADS
AVAPLALEILQAVGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3V129	0.685	0.670	0.000	1303	0.824	0.807	Q3V129.pdb.gz	ULK4_MOUSE Serine/threonine-protein kinase ULK4 OS=Mus musculus OX=10090 GN=Ulk4 PE=1 SV=2
2	AFDB:Q96C45	1.000	1.000	0.000	1275	1.000	1.000	Q96C45.pdb.gz	ULK4_HUMAN Serine/threonine-protein kinase ULK4 OS=Homo sapiens OX=9606 GN=ULK4 PE=1 SV=2
3	AFDB:F4JY37	0.596	0.563	1.922E-42	1366	0.245	0.228	F4JY37.pdb.gz	RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana OX=3702 GN=RUK PE=1 SV=1
4	AFDB:Q384K4	0.505	0.513	1.099E-35	1253	0.210	0.214	Q384K4.pdb.gz	Q384K4_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0400 PE=4 SV=1
5	AFDB:P41892	0.230	0.266	7.343E-21	1062	0.158	0.190	P41892.pdb.gz	CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc7 PE=1 SV=1
6	AFDB:Q8T2I8	0.182	0.199	1.640E-17	1167	0.161	0.176	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
7	AFDB:Q5B4Z3	0.261	0.250	2.650E-17	1346	0.165	0.157	Q5B4Z3.pdb.gz	SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sepH PE=3 SV=2
8	AFDB:Q94C95	0.195	0.384	3.562E-15	626	0.105	0.214	Q94C95.pdb.gz	ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1
9	AFDB:P23647	0.188	0.294	5.373E-15	805	0.115	0.181	P23647.pdb.gz	FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster OX=7227 GN=fu PE=1 SV=2
10	AFDB:Q9VU14	0.183	0.276	7.474E-13	835	0.120	0.183	Q9VU14.pdb.gz	Q9VU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=2 SV=1
11	PDB:4krcA	0.181	0.740	2.374E-11	297	0.064	0.273	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
12	PDB:4c0tA	0.184	0.762	7.357E-11	291	0.049	0.213	4c0tA.pdb.gz
13	PDB:3eqdA	0.183	0.683	2.359E-10	315	0.060	0.244	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:4zhxA	0.180	0.541	2.526E-10	409	0.051	0.159	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:5ufuA	0.181	0.596	2.999E-10	369	0.055	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:2yaaA	0.182	0.726	3.323E-10	300	0.060	0.253	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:5u6yA	0.177	0.476	3.439E-10	459	0.064	0.179	5u6yA.pdb.gz
18	PDB:4eomC	0.183	0.781	5.751E-10	276	0.061	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:4cztD	0.178	0.676	5.951E-10	302	0.058	0.245	4cztD.pdb.gz
20	PDB:6b1uA	0.187	0.519	5.951E-10	442	0.053	0.154	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V129	0.0	2131	1303	0.822	0.804	ULK4_MOUSE Serine/threonine-protein kinase ULK4 OS=Mus musculus OX=10090 GN=Ulk4 PE=1 SV=2
2	Q96C45	0.0	2606	1275	1.000	1.000	ULK4_HUMAN Serine/threonine-protein kinase ULK4 OS=Homo sapiens OX=9606 GN=ULK4 PE=1 SV=2
3	F4JY37	5.05e-59	225	1366	0.084	0.078	RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana OX=3702 GN=RUK PE=1 SV=1
4	Q384K4	1.59e-46	185	1253	0.077	0.078	Q384K4_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0400 PE=4 SV=1
5	A8WFS2	3.00e-37	155	1231	0.078	0.081	A8WFS2_DANRE Serine/threonine kinase 36 (fused homolog, Drosophila) OS=Danio rerio OX=7955 GN=fu PE=2 SV=1
6	A0A140VJW1	6.47e-37	154	1315	0.075	0.073	A0A140VJW1_HUMAN Testicular tissue protein Li 188 OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q9NRP7	6.47e-37	154	1315	0.075	0.073	STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens OX=9606 GN=STK36 PE=1 SV=2
8	Q69ZM6	2.18e-36	152	1316	0.075	0.073	STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus OX=10090 GN=Stk36 PE=1 SV=3
9	Q6PHR2	8.22e-34	139	472	0.075	0.203	ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens OX=9606 GN=ULK3 PE=1 SV=2
10	Q2QAV0	4.56e-32	138	1322	0.069	0.067	TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana OX=3702 GN=TIO PE=1 SV=1
11	Q9VHF6	2.31e-30	129	520	0.064	0.156	Q9VHF6_DROME Serine/threonine-protein kinase ULK3 OS=Drosophila melanogaster OX=7227 GN=Aduk PE=4 SV=1
12	B5MF71	3.15e-30	126	368	0.084	0.291	B5MF71_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
13	B5MF72	5.15e-30	126	392	0.095	0.309	B5MF72_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
14	Q55FT4	1.57e-29	130	2247	0.067	0.038	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
15	Q8BW96	1.71e-29	124	385	0.075	0.247	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
16	Q8IU85	3.59e-29	123	385	0.074	0.244	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
17	B1H1J7	1.70e-28	122	433	0.076	0.224	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
18	Q94C95	2.36e-28	124	626	0.070	0.142	ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1
19	O70150	3.01e-28	119	343	0.066	0.245	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
20	O43293	4.02e-28	121	454	0.068	0.192	DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	5.2	18.5	Armadillo/beta-catenin-like repeat
2	PF12717 Cnd1	1.5e+02	13.8	non-SMC mitotic condensation complex subunit 1
3	PF11865 DUF3385	1.6e+02	13.6	Domain of unknown function (DUF3385)
4	PF11841 ELMO_ARM	0.4	22.1	ELMO, armadillo-like helical domain
5	PF02985 HEAT	15	17.2	HEAT repeat
6	PF13646 HEAT_2	1.3e+02	14.4	HEAT repeats
7	PF07923 N1221	3.3e+02	11.9	N1221-like protein
8	PF00069 Pkinase	3.6e-45	166.0	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.2e-21	88.7	Protein tyrosine and serine/threonine kinase
10	PF14668 RICTOR_V	10	17.7	Rapamycin-insensitive companion of mTOR, domain 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.797	Suppressor of fused homolog
2	9606.ENSP00000347883	0.698	Pleckstrin homology domain-containing family A member 7
3	9606.ENSP00000378063	0.601	Schlafen family member 12
4	9606.ENSP00000299847	0.586	CHRNA7-FAM7A fusion protein
5	9606.ENSP00000383986	0.565	Cell division cycle-associated 7-like protein
6	9606.ENSP00000437635	0.539	Schlafen family member 12 like
7	9606.ENSP00000479636	0.518	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
8	9606.ENSP00000392043	0.517	Plasma membrane calcium-transporting ATPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0007017	0.984	microtubule-based process
GO:0050794	0.981	regulation of cellular process
GO:0016043	0.907	cellular component organization
GO:0006996	0.865	organelle organization
GO:0010646	0.764	regulation of cell communication
GO:0023051	0.753	regulation of signaling
GO:0048583	0.748	regulation of response to stimulus
GO:0007010	0.733	cytoskeleton organization
GO:0009966	0.701	regulation of signal transduction
GO:0000226	0.591	microtubule cytoskeleton organization
GO:0008152	0.503	metabolic process
GO:0050896	0.475	response to stimulus
GO:2000145	0.451	regulation of cell motility
GO:0070302	0.450	regulation of stress-activated protein kinase signaling cascade
GO:0032501	0.445	multicellular organismal process
GO:2001222	0.416	regulation of neuron migration
GO:0032872	0.381	regulation of stress-activated MAPK cascade
GO:1900744	0.312	regulation of p38MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005737	0.998	cytoplasm
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0005829	0.893	cytosol
GO:0120025	0.831	plasma membrane bounded cell projection
GO:0016020	0.826	membrane
GO:0043231	0.763	intracellular membrane-bounded organelle
GO:0005929	0.756	cilium
GO:0032991	0.732	protein-containing complex
GO:0005856	0.517	cytoskeleton
GO:0015630	0.390	microtubule cytoskeleton
GO:0012505	0.340	endomembrane system
GO:0005634	0.323	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]