StarFunc result for job id Q96C55

User Input

>input (264 residues)
MDTPSPDPLPSPLPGEEEKPLALSPPVPRGRRGRRPGGATSSNRTLKASLPRKRGRPPKS
GQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEGSAAGPEGSGPRKAPHFCPVCL
RAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFR
EAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPW
DEEGIPATAGAEEEEETEGKGEPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96C55	1.000	1.000	1.408E-45	264	1.000	1.000	Q96C55.pdb.gz	ZN524_HUMAN Zinc finger protein 524 OS=Homo sapiens OX=9606 GN=ZNF524 PE=1 SV=1
2	AFDB:A0A3Q1MB73	0.331	0.164	3.826E-14	588	0.356	0.160	A0A3Q1MB73.pdb.gz	A0A3Q1MB73_BOVIN FLT3 interacting zinc finger 1 OS=Bos taurus OX=9913 GN=FIZ1 PE=4 SV=1
3	AFDB:Q9VDQ4	0.406	0.251	5.158E-13	439	0.231	0.139	Q9VDQ4.pdb.gz	Q9VDQ4_DROME Trade embargo OS=Drosophila melanogaster OX=7227 GN=trem PE=1 SV=2
4	AFDB:Q9H7X3	0.400	0.286	6.690E-13	374	0.261	0.184	Q9H7X3.pdb.gz	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
5	AFDB:Q9VDQ3	0.405	0.210	1.055E-12	521	0.235	0.119	Q9VDQ3.pdb.gz	Q9VDQ3_DROME LD08906p OS=Drosophila melanogaster OX=7227 GN=idc PE=1 SV=1
6	AFDB:P10073	0.390	0.223	1.368E-12	491	0.205	0.110	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
7	AFDB:Q8BFS8	0.411	0.171	1.460E-12	652	0.186	0.075	Q8BFS8.pdb.gz	ZN418_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=ZNF418 PE=2 SV=1
8	AFDB:Q96C28	0.415	0.305	1.460E-12	371	0.261	0.186	Q96C28.pdb.gz	ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens OX=9606 GN=ZNF707 PE=1 SV=2
9	AFDB:E7FBX7	0.251	0.200	1.558E-12	334	0.265	0.210	E7FBX7.pdb.gz	E7FBX7_DANRE Growth factor-independent 1B transcription repressor OS=Danio rerio OX=7955 GN=si:ch211-231o6.2 PE=4 SV=1
10	AFDB:Q15937	0.424	0.232	1.894E-12	498	0.242	0.129	Q15937.pdb.gz	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
11	PDB:3w5kB	0.155	0.292	4.304E-4	110	0.136	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ad8D	0.084	0.081	1.201	280	0.102	0.096	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
13	PDB:4kfzB	0.108	0.168	1.774	148	0.053	0.095	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:5a31B	0.084	0.196	2.020	84	0.068	0.214	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
15	PDB:7ena2	0.073	0.055	2.156	385	0.087	0.060	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:8a3tU	0.075	0.130	2.455	114	0.080	0.184	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:7uhyC	0.081	0.044	4.705	578	0.057	0.026	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:5apny	0.091	0.113	5.718	211	0.057	0.071	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
19	PDB:6hlqI	0.084	0.166	5.718	111	0.045	0.108	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
20	PDB:6hivCv	0.087	0.027	6.103	1059	0.068	0.017	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96C55	0.0	524	264	1.000	1.000	ZN524_HUMAN Zinc finger protein 524 OS=Homo sapiens OX=9606 GN=ZNF524 PE=1 SV=1
2	Q9P0T4	3.39e-51	167	197	0.379	0.508	ZN581_HUMAN Zinc finger protein 581 OS=Homo sapiens OX=9606 GN=ZNF581 PE=1 SV=1
3	Q9WTJ4	7.09e-29	116	500	0.227	0.120	FIZ1_MOUSE Flt3-interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Fiz1 PE=1 SV=1
4	A0A3Q1MB73	2.01e-28	115	588	0.216	0.097	A0A3Q1MB73_BOVIN FLT3 interacting zinc finger 1 OS=Bos taurus OX=9913 GN=FIZ1 PE=4 SV=1
5	Q8CJ78	1.07e-26	110	1038	0.197	0.050	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
6	Q5EBL2	1.92e-26	110	1059	0.197	0.049	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
7	P10073	1.29e-25	107	491	0.231	0.124	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
8	Q9VDQ3	2.03e-25	106	521	0.167	0.084	Q9VDQ3_DROME LD08906p OS=Drosophila melanogaster OX=7227 GN=idc PE=1 SV=1
9	O88282	4.34e-25	105	474	0.261	0.146	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1
10	Q8N143	6.57e-25	105	479	0.277	0.152	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
11	A8KA13	6.61e-25	105	480	0.277	0.152	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
12	Q9UK33	1.78e-24	98.2	172	0.216	0.331	ZN580_HUMAN Zinc finger protein 580 OS=Homo sapiens OX=9606 GN=ZNF580 PE=1 SV=1
13	P13360	6.37e-24	102	604	0.159	0.070	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
14	Q6DD87	8.73e-24	100	382	0.212	0.147	ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4
15	M9PBR0	1.04e-23	102	1216	0.159	0.035	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
16	Q68EH4	1.10e-23	102	776	0.189	0.064	Q68EH4_DANRE PR domain zinc finger protein 1 OS=Danio rerio OX=7955 GN=Blimp-1 PE=2 SV=2
17	Q9VRN4	1.22e-23	102	1203	0.159	0.035	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
18	Q96NJ6	1.34e-23	101	502	0.231	0.122	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1
19	Q96JF6	1.56e-23	101	807	0.182	0.059	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
20	A0A0R4YI50	2.19e-23	101	698	0.174	0.066	A0A0R4YI50_DROME Earmuff, isoform D OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	9.2e+02	11.6	BolA-like protein
2	PF19126 DUF5810	0.35	22.3	Family of unknown function (DUF5810)
3	PF15750 UBZ_FAAP20	30	15.9	Ubiquitin-binding zinc-finger
4	PF00096 zf-C2H2	3.3e-12	57.3	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	40	15.4	zinc-finger C2H2-type
6	PF18658 zf-C2H2_12	7.2e+02	11.3	Spin-doc zinc-finger
7	PF12756 zf-C2H2_2	7.8e+02	11.8	C2H2 type zinc-finger (2 copies)
8	PF13894 zf-C2H2_4	1e-10	52.5	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.006	27.8	C2H2-type zinc finger
10	PF16293 zf-C2H2_9	2	19.6	C2H2 type zinc-finger (1 copy)
11	PF12171 zf-C2H2_jaz	0.0042	28.6	Zinc-finger double-stranded RNA-binding
12	PF05605 zf-Di19	0.83	21.3	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	2.3e-14	64.3	Zinc-finger double domain
14	PF12874 zf-met	0.0075	27.8	Zinc-finger of C2H2 type
15	PF12907 zf-met2	1e+02	14.4	Zinc-binding
16	PF18112 Zn-C2H2_12	2e+02	13.7	Autophagy receptor zinc finger-C2H2 domain
17	PF17283 Zn_ribbon_SprT	3.4e+02	12.7	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263736	0.721	S1 RNA-binding domain-containing protein 1
2	9606.ENSP00000346644	0.706	Ribosomal protein S6 kinase like 1
3	9606.ENSP00000420405	0.636	Fibrinogen silencer-binding protein
4	9606.ENSP00000358576	0.573	5' exonuclease Apollo
5	9606.ENSP00000362170	0.552	Nuclear apoptosis-inducing factor 1
6	9606.ENSP00000406046	0.551	DNA polymerase delta catalytic subunit
7	9606.ENSP00000380516	0.520	Homeobox-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.942	cellular process
GO:0050794	0.914	regulation of cellular process
GO:0019222	0.864	regulation of metabolic process
GO:0031326	0.708	regulation of cellular biosynthetic process
GO:0010468	0.706	regulation of gene expression
GO:0080090	0.702	regulation of primary metabolic process
GO:0010556	0.696	regulation of macromolecule biosynthetic process
GO:0051171	0.693	regulation of nitrogen compound metabolic process
GO:0019219	0.653	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.635	negative regulation of biological process
GO:0051252	0.587	regulation of RNA metabolic process
GO:0006355	0.556	regulation of DNA-templated transcription
GO:0008152	0.551	metabolic process
GO:0048523	0.526	negative regulation of cellular process
GO:0009892	0.460	negative regulation of metabolic process
GO:0032502	0.459	developmental process
GO:0010605	0.453	negative regulation of macromolecule metabolic process
GO:0071704	0.414	organic substance metabolic process
GO:0031324	0.399	negative regulation of cellular metabolic process
GO:0051172	0.395	negative regulation of nitrogen compound metabolic process
GO:0031327	0.370	negative regulation of cellular biosynthetic process
GO:0044238	0.365	primary metabolic process
GO:0045934	0.365	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.364	negative regulation of macromolecule biosynthetic process
GO:0044237	0.347	cellular metabolic process
GO:0045892	0.337	negative regulation of DNA-templated transcription
GO:0050896	0.333	response to stimulus
GO:0006357	0.310	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.965	non-membrane-bounded organelle
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005694	0.890	chromosome
GO:0005737	0.729	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]