StarFunc result for job id Q96C92

User Input

>input (435 residues)
MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMC
YVPSPVLASVGDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNL
GLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDE
DTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVS
PASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVR
TLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVS
NFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILK
SIDRISEVKDEEEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96C92	1.000	1.000	9.197E-62	435	1.000	1.000	Q96C92.pdb.gz	ENTR1_HUMAN Endosome-associated-trafficking regulator 1 OS=Homo sapiens OX=9606 GN=ENTR1 PE=1 SV=3
2	AFDB:A0A288CG34	0.262	0.177	1.868E-4	709	0.182	0.111	A0A288CG34.pdb.gz
3	AFDB:Q8CFC9	0.220	0.166	2.151E-4	601	0.179	0.130	Q8CFC9.pdb.gz	LZTS1_RAT Leucine zipper putative tumor suppressor 1 OS=Rattus norvegicus OX=10116 GN=Lzts1 PE=1 SV=3
4	AFDB:Q9BPU3	0.182	0.114	1.252E-3	792	0.152	0.083	Q9BPU3.pdb.gz	KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum OX=44689 GN=kif2 PE=2 SV=1
5	AFDB:M9NDQ8	0.274	0.234	1.546E-3	530	0.140	0.115	M9NDQ8.pdb.gz	M9NDQ8_DROME Nuclear fallout, isoform G OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
6	AFDB:Q18452	0.306	0.268	1.546E-3	512	0.136	0.115	Q18452.pdb.gz	MAP9_CAEEL Protein maph-9 OS=Caenorhabditis elegans OX=6239 GN=maph-9 PE=2 SV=2
7	AFDB:Q9UPV0	0.229	0.080	1.546E-3	1460	0.166	0.049	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
8	AFDB:Q08581	0.336	0.186	2.360E-3	821	0.147	0.078	Q08581.pdb.gz	SLK19_YEAST Kinetochore protein SLK19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLK19 PE=1 SV=1
9	AFDB:Q9I7U5	0.267	0.176	2.360E-3	689	0.149	0.094	Q9I7U5.pdb.gz	Q9I7U5_DROME Centrobin, isoform A OS=Drosophila melanogaster OX=7227 GN=Cnb PE=4 SV=1
10	AFDB:Q9ULG6	0.228	0.142	2.360E-3	757	0.149	0.086	Q9ULG6.pdb.gz	CCPG1_HUMAN Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96C92	0.0	897	435	1.000	1.000	ENTR1_HUMAN Endosome-associated-trafficking regulator 1 OS=Homo sapiens OX=9606 GN=ENTR1 PE=1 SV=3
2	Q925B0	0.14	36.6	333	0.080	0.105	PAWR_MOUSE PRKC apoptosis WT1 regulator protein OS=Mus musculus OX=10090 GN=Pawr PE=1 SV=2
3	Q6P0E7	0.28	35.8	423	0.062	0.064	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1
4	Q62627	0.29	35.8	332	0.064	0.084	PAWR_RAT PRKC apoptosis WT1 regulator protein OS=Rattus norvegicus OX=10116 GN=Pawr PE=1 SV=1
5	Q96IZ0	0.30	35.8	340	0.067	0.085	PAWR_HUMAN PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1
6	Q9LZ83	0.48	35.0	514	0.060	0.051	Q9LZ83_ARATH AT5G04420 protein OS=Arabidopsis thaliana OX=3702 GN=T32M21_20 PE=1 SV=1
7	Q78PB6	0.55	34.7	345	0.067	0.084	NDEL1_RAT Nuclear distribution protein nudE-like 1 OS=Rattus norvegicus OX=10116 GN=Ndel1 PE=1 SV=1
8	Q9ERR1	0.55	34.7	345	0.067	0.084	NDEL1_MOUSE Nuclear distribution protein nudE-like 1 OS=Mus musculus OX=10090 GN=Ndel1 PE=1 SV=2
9	F4I5Q6	0.64	35.0	1730	0.087	0.022	MYO7_ARATH Myosin-7 OS=Arabidopsis thaliana OX=3702 GN=XI-A PE=3 SV=1
10	P70403	0.65	35.0	678	0.099	0.063	CASP_MOUSE Protein CASP OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=2
11	Q9GZM8	0.69	34.7	345	0.067	0.084	NDEL1_HUMAN Nuclear distribution protein nudE-like 1 OS=Homo sapiens OX=9606 GN=NDEL1 PE=1 SV=1
12	A0A2R8QCI3	0.87	34.7	2023	0.083	0.018	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
13	P53564	0.95	34.7	1515	0.090	0.026	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
14	D3ZYD7	0.98	34.3	1523	0.083	0.024	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
15	P53565	0.99	34.3	1504	0.090	0.026	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
16	A0A8I5ZW24	1.1	34.3	1845	0.083	0.020	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
17	A0A8I6A5W7	1.1	34.3	1873	0.083	0.019	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
18	Q8N1N4	1.2	33.9	520	0.044	0.037	K2C78_HUMAN Keratin, type II cytoskeletal 78 OS=Homo sapiens OX=9606 GN=KRT78 PE=1 SV=2
19	P43557	1.5	33.1	207	0.076	0.159	FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP32 PE=1 SV=1
20	Q53GS7	1.5	33.5	698	0.099	0.062	GLE1_HUMAN mRNA export factor GLE1 OS=Homo sapiens OX=9606 GN=GLE1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	39	14.4	AAA domain
2	PF02916 DNA_PPF	3.5e+02	13.0	DNA polymerase processivity factor
3	PF13863 DUF4200	7.3e+02	11.9	Domain of unknown function (DUF4200)
4	PF05266 DUF724	1.7e+02	13.5	Protein of unknown function (DUF724)
5	PF02183 HALZ	1.4e+02	14.1	Homeobox associated leucine zipper
6	PF15619 Lebercilin	1e+02	14.0	Ciliary protein causing Leber congenital amaurosis disease
7	PF16026 MIEAP	3e+02	12.8	Mitochondria-eating protein
8	PF07926 TPR_MLP1_2	12	17.3	TPR/MLP1/MLP2-like protein
9	PF00261 Tropomyosin	29	15.4	Tropomyosin
10	PF01166 TSC22	5.7	18.5	TSC-22/dip/bun family
11	PF06005 ZapB	1.1e+02	14.7	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334767	0.749	Coiled-coil domain containing 84
2	9606.ENSP00000394794	0.717	Tyrosine-protein phosphatase non-receptor type 13
3	9606.ENSP00000378338	0.698	ARF GTPase-activating protein GIT1
4	9606.ENSP00000472836	0.682	KxDL motif-containing protein 1
5	9606.ENSP00000367991	0.642	Septin-8
6	9606.ENSP00000351207	0.624	Uncharacterized protein KIAA1671
7	9606.ENSP00000425658	0.621	Ankyrin repeat domain-containing protein 50
8	9606.ENSP00000398930	0.610	Epsilon-sarcoglycan
9	9606.ENSP00000281187	0.607	Vacuolar protein sorting-associated protein 26B
10	9606.ENSP00000304292	0.576	Ankyrin repeat domain-containing protein 27
11	9606.ENSP00000298532	0.548	snRNA-activating protein complex subunit 4
12	9606.ENSP00000362480	0.546	Vacuolar protein sorting-associated protein 26A
13	9606.ENSP00000170564	0.519	G-patch domain containing 1
14	9606.ENSP00000360782	0.506	Mitochondrial-processing peptidase subunit alpha
15	9606.ENSP00000399356	0.505	Cancer/testis antigen 62
16	9606.ENSP00000300589	0.502	Nucleotide-binding oligomerization domain-containing protein 2
17	9606.ENSP00000416797	0.502	Calmodulin-regulated spectrin-associated protein 3
18	9606.ENSP00000480853	0.502	Vacuolar protein sorting-associated protein 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051179	0.971	localization
GO:0044087	0.969	regulation of cellular component biogenesis
GO:0048522	0.964	positive regulation of cellular process
GO:0051641	0.963	cellular localization
GO:0051649	0.953	establishment of localization in cell
GO:0051128	0.928	regulation of cellular component organization
GO:0033043	0.910	regulation of organelle organization
GO:0031344	0.910	regulation of cell projection organization
GO:0006810	0.883	transport
GO:1902115	0.857	regulation of organelle assembly
GO:0060491	0.854	regulation of cell projection assembly
GO:0120032	0.827	regulation of plasma membrane bounded cell projection assembly
GO:1902017	0.778	regulation of cilium assembly
GO:0046907	0.731	intracellular transport
GO:0016192	0.682	vesicle-mediated transport
GO:0051726	0.658	regulation of cell cycle
GO:0016197	0.625	endosomal transport
GO:0051130	0.564	positive regulation of cellular component organization
GO:0010638	0.552	positive regulation of organelle organization
GO:0098876	0.550	vesicle-mediated transport to the plasma membrane
GO:0010564	0.532	regulation of cell cycle process
GO:0032456	0.528	endocytic recycling
GO:0032879	0.500	regulation of localization
GO:0044089	0.471	positive regulation of cellular component biogenesis
GO:0051302	0.464	regulation of cell division
GO:0032465	0.448	regulation of cytokinesis
GO:0019222	0.395	regulation of metabolic process
GO:1902117	0.391	positive regulation of organelle assembly
GO:0031323	0.373	regulation of cellular metabolic process
GO:0120034	0.343	positive regulation of plasma membrane bounded cell projection assembly
GO:0060341	0.331	regulation of cellular localization
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	1.000	microtubule organizing center
GO:0005768	0.997	endosome
GO:0098796	0.995	membrane protein complex
GO:0005813	0.992	centrosome
GO:0030904	0.989	retromer complex
GO:0005769	0.987	early endosome
GO:0005929	0.986	cilium
GO:0055037	0.984	recycling endosome
GO:0030496	0.976	midbody
GO:0036064	0.974	ciliary basal body
GO:0005829	0.844	cytosol
GO:0031090	0.477	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]