StarFunc result for job id Q96CA5

User Input

>input (298 residues)
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CA5	1.000	1.000	8.925E-55	298	1.000	1.000	Q96CA5.pdb.gz	BIRC7_HUMAN Baculoviral IAP repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=BIRC7 PE=1 SV=2
2	AFDB:A2AWP0	0.561	0.584	5.543E-34	285	0.638	0.667	A2AWP0.pdb.gz	BIRC7_MOUSE Baculoviral IAP repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1
3	AFDB:Q8JHV9	0.345	0.263	7.071E-20	401	0.349	0.259	Q8JHV9.pdb.gz	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
4	AFDB:Q24306	0.319	0.219	2.321E-18	438	0.262	0.178	Q24306.pdb.gz	DIAP1_DROME Death-associated inhibitor of apoptosis 1 OS=Drosophila melanogaster OX=7227 GN=Diap1 PE=1 SV=2
5	AFDB:Q60989	0.319	0.194	6.292E-18	496	0.275	0.165	Q60989.pdb.gz	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
6	AFDB:H0YZU0	0.300	0.186	4.923E-17	485	0.282	0.173	H0YZU0.pdb.gz	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
7	AFDB:Q6PIA0	0.304	0.380	7.157E-17	236	0.255	0.322	Q6PIA0.pdb.gz	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
8	AFDB:O08863	0.336	0.177	7.617E-17	600	0.379	0.188	O08863.pdb.gz	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
9	AFDB:A8MTF4	0.217	0.333	9.183E-17	193	0.440	0.679	A8MTF4.pdb.gz	A8MTF4_HUMAN Baculoviral IAP repeat containing 7 OS=Homo sapiens OX=9606 GN=BIRC7 PE=1 SV=1
10	AFDB:P98170	0.337	0.206	9.774E-17	497	0.258	0.155	P98170.pdb.gz	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
11	PDB:5yudA	0.267	0.066	2.205E-6	1238	0.138	0.033	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
12	PDB:3uedC	0.212	0.437	9.250E-6	139	0.104	0.223	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
13	PDB:6b5bA	0.281	0.073	9.250E-6	1199	0.138	0.034	6b5bA.pdb.gz
14	PDB:1m4mA	0.220	0.548	3.425E-5	112	0.107	0.286	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
15	PDB:4r8pL	0.157	0.182	5.709E-2	254	0.074	0.087	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:5dkaA	0.129	0.357	1.133E-1	96	0.060	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:5gm6a	0.137	0.310	3.481E-1	123	0.044	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7dd9A	0.124	0.037	1.069	1129	0.054	0.014	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
19	PDB:7ddeA	0.111	0.067	1.372	525	0.050	0.029	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
20	PDB:6fyxm	0.097	0.168	1.654	147	0.044	0.088	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CA5	0.0	600	298	1.000	1.000	BIRC7_HUMAN Baculoviral IAP repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=BIRC7 PE=1 SV=2
2	A2AWP0	1.34e-120	348	285	0.638	0.667	BIRC7_MOUSE Baculoviral IAP repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Birc7 PE=2 SV=1
3	A8MTF4	2.40e-82	248	193	0.440	0.679	A8MTF4_HUMAN Baculoviral IAP repeat containing 7 OS=Homo sapiens OX=9606 GN=BIRC7 PE=1 SV=1
4	Q8JHV9	4.18e-57	190	401	0.433	0.322	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
5	Q60989	8.02e-41	149	496	0.289	0.173	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
6	P98170	1.18e-39	146	497	0.275	0.165	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
7	A5D8Q0	1.94e-39	145	488	0.285	0.174	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
8	Q6PIA0	3.07e-39	139	236	0.275	0.347	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
9	H0YZU0	3.58e-39	145	485	0.312	0.192	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
10	Q9R0I6	6.70e-39	144	496	0.295	0.177	XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1
11	Q24306	7.09e-32	124	438	0.248	0.169	DIAP1_DROME Death-associated inhibitor of apoptosis 1 OS=Drosophila melanogaster OX=7227 GN=Diap1 PE=1 SV=2
12	P41437	1.01e-31	120	268	0.242	0.269	IAP3_NPVOP E3 ubiquitin-protein ligase IAP-3 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus OX=262177 GN=IAP3 PE=3 SV=1
13	O08863	6.77e-28	115	600	0.188	0.093	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
14	Q13489	9.16e-28	114	604	0.174	0.086	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
15	Q6P6S1	8.08e-27	112	589	0.174	0.088	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
16	Q5XIW4	8.16e-27	112	602	0.185	0.091	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
17	A0A0G2JTI9	8.22e-27	112	638	0.185	0.086	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
18	F7FLN8	8.32e-27	112	602	0.185	0.091	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
19	A0A8I6ADV9	1.11e-26	111	537	0.174	0.097	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
20	Q13490	3.01e-26	110	618	0.185	0.089	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	6.5e-18	76.5	Inhibitor of Apoptosis domain
2	PF10217 DUF2039	16	17.2	Uncharacterized conserved protein (DUF2039)
3	PF14447 Prok-RING_4	0.0001	33.4	Prokaryotic RING finger family 4
4	PF15616 TerY_C	41	15.7	TerY-C metal binding domain
5	PF00097 zf-C3HC4	1.9	19.7	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	26	16.1	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	2.6e-09	48.1	Zinc finger, C3HC4 type (RING finger)
8	PF13639 zf-RING_2	13	17.6	Ring finger domain
9	PF14634 zf-RING_5	0.098	24.0	zinc-RING finger domain
10	PF13445 zf-RING_UBOX	6.6	18.2	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398495	0.998	Diablo homolog, mitochondrial
2	9606.ENSP00000381717	0.996	Ubiquitin-conjugating enzyme E2 D2
3	9606.ENSP00000311032	0.987	Caspase-3
4	9606.ENSP00000330237	0.982	Caspase-9
5	9606.ENSP00000441543	0.949	Polyubiquitin-C
6	9606.ENSP00000358327	0.946	Caspase-7
7	9606.ENSP00000258080	0.889	Serine protease HTRA2, mitochondrial
8	9606.ENSP00000304697	0.832	Polyubiquitin-B
9	9606.ENSP00000393596	0.820	Baculoviral IAP repeat-containing protein 6
10	9606.ENSP00000477613	0.795	Baculoviral IAP repeat-containing protein 2
11	9606.ENSP00000360242	0.732	E3 ubiquitin-protein ligase XIAP
12	9606.ENSP00000302898	0.711	Aurora kinase C
13	9606.ENSP00000313950	0.705	Aurora kinase B
14	9606.ENSP00000216911	0.684	Aurora kinase A
15	9606.ENSP00000301633	0.680	Baculoviral IAP repeat containing 5
16	9606.ENSP00000345708	0.654	ATP-sensitive inward rectifier potassium channel 11
17	9606.ENSP00000363019	0.638	Ubiquitin-conjugating enzyme E2 D1
18	9606.ENSP00000426503	0.637	E3 ubiquitin-protein ligase RNF4
19	9606.ENSP00000258991	0.636	Testis-expressed protein 2
20	9606.ENSP00000351273	0.619	Caspase-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0004869	0.999	cysteine-type endopeptidase inhibitor activity
GO:0019899	0.586	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.992	primary metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0043170	0.986	macromolecule metabolic process
GO:0048583	0.984	regulation of response to stimulus
GO:0048522	0.979	positive regulation of cellular process
GO:0019538	0.979	protein metabolic process
GO:0023051	0.977	regulation of signaling
GO:0010646	0.977	regulation of cell communication
GO:0009966	0.974	regulation of signal transduction
GO:0036211	0.969	protein modification process
GO:0032446	0.949	protein modification by small protein conjugation
GO:0048519	0.937	negative regulation of biological process
GO:0043067	0.921	regulation of programmed cell death
GO:0048523	0.912	negative regulation of cellular process
GO:0042981	0.912	regulation of apoptotic process
GO:0043069	0.900	negative regulation of programmed cell death
GO:0048584	0.853	positive regulation of response to stimulus
GO:1902533	0.839	positive regulation of intracellular signal transduction
GO:0080135	0.817	regulation of cellular response to stress
GO:0001959	0.805	regulation of cytokine-mediated signaling pathway
GO:0043066	0.795	negative regulation of apoptotic process
GO:0043410	0.699	positive regulation of MAPK cascade
GO:0009987	0.680	cellular process
GO:0070302	0.678	regulation of stress-activated protein kinase signaling cascade
GO:0010803	0.675	regulation of tumor necrosis factor-mediated signaling pathway
GO:0032872	0.666	regulation of stress-activated MAPK cascade
GO:0070304	0.661	positive regulation of stress-activated protein kinase signaling cascade
GO:0048585	0.649	negative regulation of response to stimulus
GO:0032874	0.649	positive regulation of stress-activated MAPK cascade
GO:0046328	0.646	regulation of JNK cascade
GO:0046330	0.610	positive regulation of JNK cascade
GO:2000106	0.577	regulation of leukocyte apoptotic process
GO:0060761	0.564	negative regulation of response to cytokine stimulus
GO:0050896	0.555	response to stimulus
GO:0070228	0.537	regulation of lymphocyte apoptotic process
GO:0016567	0.528	protein ubiquitination
GO:0010648	0.499	negative regulation of cell communication
GO:0009968	0.480	negative regulation of signal transduction
GO:0019222	0.463	regulation of metabolic process
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0051716	0.431	cellular response to stimulus
GO:0080090	0.405	regulation of primary metabolic process
GO:0051171	0.389	regulation of nitrogen compound metabolic process
GO:0001960	0.346	negative regulation of cytokine-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0005856	0.985	cytoskeleton
GO:0015630	0.945	microtubule cytoskeleton
GO:0005815	0.909	microtubule organizing center
GO:0016020	0.890	membrane
GO:0005813	0.830	centrosome
GO:0005794	0.773	Golgi apparatus
GO:0032991	0.498	protein-containing complex
GO:0005886	0.373	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]