StarFunc result for job id Q96CB9

User Input

>input (384 residues)
MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLW
PSIRVSLLSEQKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
ASWACSPNLRCFTFDRGDISRFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDL
CAAPGGKTLALLQTGCCRNLAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRK
WGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATK
PGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLTHFRRVFMDTFCFFSSCQV
GELVIPNLMANFGPMYFCKMRRLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CB9	1.000	1.000	6.913E-84	384	1.000	1.000	Q96CB9.pdb.gz	NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4 PE=1 SV=2
2	AFDB:Q9CZ57	0.917	0.924	6.034E-73	381	0.857	0.864	Q9CZ57.pdb.gz	NSUN4_MOUSE 5-methylcytosine rRNA methyltransferase NSUN4 OS=Mus musculus OX=10090 GN=Nsun4 PE=1 SV=1
3	PDB:7of5C	0.852	0.966	1.178E-65	338	0.880	1.000	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
4	PDB:7pd3x	0.882	0.924	1.588E-62	366	0.953	1.000	7pd3x.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
5	AFDB:Q95XR2	0.815	0.675	6.336E-41	465	0.365	0.301	Q95XR2.pdb.gz	NSUN4_CAEEL 5-methylcytosine rRNA methyltransferase nsun-4 OS=Caenorhabditis elegans OX=6239 GN=nsun-4 PE=1 SV=1
6	AFDB:Q9H649	0.749	0.842	6.101E-34	340	0.299	0.338	Q9H649.pdb.gz	NSUN3_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=NSUN3 PE=1 SV=1
7	AFDB:Q381M3	0.625	0.710	5.220E-24	335	0.240	0.275	Q381M3.pdb.gz	Q381M3_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7280 PE=3 SV=1
8	AFDB:Q9TYV5	0.583	0.349	1.026E-19	664	0.195	0.113	Q9TYV5.pdb.gz	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
9	AFDB:Q8VYM6	0.553	0.332	1.653E-19	671	0.195	0.112	Q8VYM6.pdb.gz	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
10	AFDB:Q9FG73	0.584	0.346	2.097E-19	682	0.195	0.110	Q9FG73.pdb.gz	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
11	AFDB:Q583H8	0.551	0.413	5.124E-19	525	0.216	0.158	Q583H8.pdb.gz	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
12	AFDB:Q9V106	0.596	0.723	5.439E-19	311	0.190	0.235	Q9V106.pdb.gz	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
13	PDB:2frxA	0.595	0.510	4.425E-17	455	0.182	0.154	2frxA.pdb.gz
14	PDB:1sqfA	0.561	0.511	1.148E-16	425	0.188	0.169	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
15	PDB:7nacq	0.562	0.598	3.159E-16	358	0.206	0.221	7nacq.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:3a4tA	0.560	0.807	7.717E-16	258	0.156	0.233	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
17	PDB:5zveB	0.551	0.551	1.126E-14	384	0.182	0.182	5zveB.pdb.gz	Archaeal NSUN6 catalyzes m5C72 modification on a wide-range of specific tRNAs.
18	PDB:5wwrA	0.536	0.457	1.428E-14	461	0.185	0.154	5wwrA.pdb.gz	Structural basis for substrate binding and catalytic mechanism of a human RNA:m5C methyltransferase NSun6
19	PDB:3c0kA	0.360	0.351	1.488E-9	395	0.117	0.114	3c0kA.pdb.gz
20	PDB:2pwyA	0.350	0.518	2.924E-8	251	0.109	0.167	2pwyA.pdb.gz	Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CB9	0.0	800	384	1.000	1.000	NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4 PE=1 SV=2
2	Q9CZ57	0.0	682	381	0.857	0.864	NSUN4_MOUSE 5-methylcytosine rRNA methyltransferase NSUN4 OS=Mus musculus OX=10090 GN=Nsun4 PE=1 SV=1
3	Q95XR2	9.07e-53	184	465	0.286	0.237	NSUN4_CAEEL 5-methylcytosine rRNA methyltransferase nsun-4 OS=Caenorhabditis elegans OX=6239 GN=nsun-4 PE=1 SV=1
4	Q9H649	3.93e-51	176	340	0.312	0.353	NSUN3_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=NSUN3 PE=1 SV=1
5	Q381M3	2.38e-24	104	335	0.198	0.227	Q381M3_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7280 PE=3 SV=1
6	Q57V63	3.88e-19	91.3	609	0.167	0.105	Q57V63_TRYB2 SAM-dependent MTase RsmB/NOP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.270 PE=3 SV=1
7	Q9TYV5	4.64e-17	85.1	664	0.195	0.113	NSUN1_CAEEL 26S rRNA (cytosine-C(5))-methyltransferase nsun-1 OS=Caenorhabditis elegans OX=6239 GN=nsun-1 PE=1 SV=2
8	O94268	8.02e-17	84.3	608	0.185	0.117	NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop2 PE=1 SV=1
9	Q583H8	8.24e-17	84.3	525	0.190	0.139	Q583H8_TRYB2 Nucleolar protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.90 PE=3 SV=1
10	P76273	2.66e-16	82.4	479	0.164	0.132	RSMF_ECOLI Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12) OX=83333 GN=rsmF PE=1 SV=2
11	Q922K7	5.24e-16	82.0	793	0.156	0.076	NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus OX=10090 GN=Nop2 PE=1 SV=1
12	P46087	2.02e-15	80.5	812	0.161	0.076	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
13	P40991	2.82e-15	79.7	618	0.164	0.102	NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP2 PE=1 SV=1
14	Q9FG73	3.97e-15	79.3	682	0.169	0.095	NOP2A_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NOP2A OS=Arabidopsis thaliana OX=3702 GN=NOP2A PE=1 SV=1
15	Q9V106	5.45e-14	74.3	311	0.146	0.180	TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB06230 PE=1 SV=1
16	Q8VYM6	3.10e-13	73.6	671	0.154	0.088	NOP2B_ARATH 26S rRNA (cytosine-C(5))-methyltransferase NOP2B OS=Arabidopsis thaliana OX=3702 GN=NOP2B PE=1 SV=1
17	P38205	2.10e-12	70.9	684	0.143	0.080	NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCL1 PE=1 SV=1
18	O13935	2.46e-12	70.9	685	0.154	0.086	TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm4b PE=1 SV=2
19	Q388U8	3.67e-12	70.1	806	0.156	0.074	Q388U8_TRYB2 Methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0530 PE=3 SV=1
20	Q60343	7.37e-12	67.4	274	0.146	0.204	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	3.8	19.1	FtsJ-like methyltransferase
2	PF13649 Methyltransf_25	17	17.5	Methyltransferase domain
3	PF01189 Methyltr_RsmB-F	5.8e-24	96.4	16S rRNA methyltransferase RsmB/F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480378	0.999	Transcription termination factor 4, mitochondrial
2	9606.ENSP00000314441	0.909	tRNA (guanine-N(7)-)-methyltransferase
3	9606.ENSP00000396673	0.869	pre-rRNA processing protein FTSJ3
4	9606.ENSP00000238146	0.835	ATP-dependent RNA helicase DDX55
5	9606.ENSP00000359859	0.815	Mitochondrial ribosome-associated GTPase 2
6	9606.ENSP00000309126	0.811	Probable 28S rRNA (cytosine-C(5))-methyltransferase
7	9606.ENSP00000302801	0.805	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
8	9606.ENSP00000306080	0.789	rRNA methyltransferase 3, mitochondrial
9	9606.ENSP00000371201	0.782	Putative methyltransferase NSUN7
10	9606.ENSP00000481559	0.780	rRNA methyltransferase 1, mitochondrial
11	9606.ENSP00000356134	0.779	Dimethyladenosine transferase 1, mitochondrial
12	9606.ENSP00000287025	0.777	Transcription termination factor 3, mitochondrial
13	9606.ENSP00000354040	0.777	Nucleolar GTP-binding protein 1
14	9606.ENSP00000242257	0.771	rRNA methyltransferase 2, mitochondrial
15	9606.ENSP00000261015	0.771	Ribosome biogenesis protein WDR12
16	9606.ENSP00000323047	0.767	Mitochondrial ribosome-associated GTPase 1
17	9606.ENSP00000203001	0.764	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
18	9606.ENSP00000366396	0.762	5'-3' exoribonuclease 2
19	9606.ENSP00000264230	0.758	Nitric oxide-associated protein 1
20	9606.ENSP00000346725	0.757	Pescadillo homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0008169	0.997	C-methyltransferase activity
GO:0008649	0.996	rRNA methyltransferase activity
GO:0005515	0.989	protein binding
GO:0003723	0.887	RNA binding
GO:0009383	0.882	rRNA (cytosine-C5-)-methyltransferase activity
GO:0008175	0.457	tRNA methyltransferase activity
GO:0016427	0.345	tRNA (cytosine) methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034660	0.995	ncRNA metabolic process
GO:0006364	0.993	rRNA processing
GO:0001510	0.991	RNA methylation
GO:0031167	0.978	rRNA methylation
GO:0065007	0.663	biological regulation
GO:0050789	0.620	regulation of biological process
GO:0050794	0.568	regulation of cellular process
GO:0019222	0.373	regulation of metabolic process
GO:0060255	0.361	regulation of macromolecule metabolic process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0080090	0.353	regulation of primary metabolic process
GO:0051171	0.353	regulation of nitrogen compound metabolic process
GO:0010468	0.318	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.991	intracellular organelle lumen
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0032991	0.907	protein-containing complex
GO:0005759	0.709	mitochondrial matrix
GO:1990904	0.597	ribonucleoprotein complex
GO:0005840	0.583	ribosome
GO:0044391	0.551	ribosomal subunit
GO:0098798	0.550	mitochondrial protein-containing complex
GO:0005654	0.464	nucleoplasm
GO:0005761	0.445	mitochondrial ribosome
GO:0015934	0.410	large ribosomal subunit

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.997	Methyltransferases.

[back to server]