StarFunc result for job id Q96CC6

User Input

>input (855 residues)
MSEARRDSTSSLQRKKPPWLKLDIPSAVPLTAEEPSFLQPLRRQAFLRSVSMPAETAHIS
SPHHELRRPVLQRQTSITQTIRRGTADWFGVSKDSDSTQKWQRKSIRHCSQRYGKLKPQV
LRELDLPSQDNVSLTSTETPPPLYVGPCQLGMQKIIDPLARGRAFRVADDTAEGLSAPHT
PVTPGAASLCSFSSSRSGFHRLPRRRKRESVAKMSFRAAAALMKGRSVRDGTFRRAQRRS
FTPASFLEEDTTDFPDELDTSFFAREGILHEELSTYPDEVFESPSEAALKDWEKAPEQAD
LTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVRLRQEVVSTAGPRRGQRIAVPV
RKLFAREKRPYGLGMVGRLTNRTYRKRIDSFVKRQIEDMDDHRPFFTYWLTFVHSLVTIL
AVCIYGIAPVGFSQHETVDSVLRNRGVYENVKYVQQENFWIGPSSEALIHLGAKFSPCMR
QDPQVHSFIRSAREREKHSACCVRNDRSGCVQTSEEECSSTLAVWVKWPIHPSAPELAGH
KRQFGSVCHQDPRVCDEPSSEDPHEWPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCC
IGTKGRCEITSREYCDFMRGYFHEEATLCSQVHCMDDVCGLLPFLNPEVPDQFYRLWLSL
FLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPA
GSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGL
FLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVVLFYVYPVRCEWCEFLTCIPF
TDKFCEKYELDAQLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CC6	1.000	1.000	0.000	855	1.000	1.000	Q96CC6.pdb.gz	RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2
2	AFDB:Q80WQ6	0.570	0.589	1.595E-91	827	0.568	0.588	Q80WQ6.pdb.gz	RHDF2_MOUSE Inactive rhomboid protein 2 OS=Mus musculus OX=10090 GN=Rhbdf2 PE=1 SV=1
3	AFDB:Q76NQ1	0.490	0.297	1.165E-50	1429	0.317	0.190	Q76NQ1.pdb.gz	RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster OX=7227 GN=rho-5 PE=2 SV=1
4	PDB:2nr9A	0.130	0.515	9.065E-3	192	0.037	0.167	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
5	PDB:3odjA	0.109	0.559	2.489E-2	157	0.027	0.146	3odjA.pdb.gz
6	AFDB:Q5PQZ5	0.054	0.090	7.716E-1	413	0.051	0.107	Q5PQZ5.pdb.gz	Q5PQZ5_DANRE SRY-box 17 OS=Danio rerio OX=7955 GN=sox17 PE=2 SV=1
7	PDB:7bssA	0.084	0.087	8.313E-1	816	0.033	0.034	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
8	PDB:7rhsD	0.054	0.091	1.028	441	0.026	0.050	7rhsD.pdb.gz
9	AFDB:B7YZV4	0.051	0.052	1.245	834	0.073	0.074	B7YZV4.pdb.gz	PDE1_DROME Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 OS=Drosophila melanogaster OX=7227 GN=Pde1c PE=1 SV=1
10	AFDB:Q57YV4	0.035	0.030	1.460	1028	0.064	0.054	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
11	PDB:3k8zA	0.035	0.066	1.492	378	0.004	0.008	3k8zA.pdb.gz
12	AFDB:Q9LQF0	0.049	0.076	1.540	341	0.054	0.135	Q9LQF0.pdb.gz	TCP23_ARATH Transcription factor TCP23 OS=Arabidopsis thaliana OX=3702 GN=TCP23 PE=1 SV=1
13	PDB:1dw9A	0.041	0.156	1.845	156	0.014	0.077	1dw9A.pdb.gz
14	PDB:7dceX	0.067	0.117	2.052	354	0.039	0.093	7dceX.pdb.gz	The tertiary structure of the human Xkr8-Basigin complex that scrambles phospholipids at plasma membranes.
15	AFDB:D4AIA8	0.038	0.041	2.119	784	0.073	0.079	D4AIA8.pdb.gz	D4AIA8_ASPOZ AAA ATPase OS=Aspergillus oryzae OX=5062 GN=aipA PE=4 SV=1
16	PDB:3k92A	0.035	0.062	2.164	418	0.007	0.014	3k92A.pdb.gz
17	PDB:2yfqB	0.035	0.062	2.282	397	0.005	0.010	2yfqB.pdb.gz
18	AFDB:Q38BW0	0.044	0.069	2.356	378	0.064	0.146	Q38BW0.pdb.gz	Q38BW0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4790 PE=4 SV=1
19	AFDB:Q57TX7	0.049	0.022	2.356	2197	0.053	0.020	Q57TX7.pdb.gz	Q57TX7_TRYB2 Kinetoplast DNA-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.380 PE=4 SV=1
20	PDB:7qskJ	0.063	0.174	2.407	175	0.029	0.143	7qskJ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PJF5	0.0	960	856	0.571	0.570	RHDF2_HUMAN Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2 PE=1 SV=2
2	Q80WQ6	0.0	959	827	0.577	0.596	RHDF2_MOUSE Inactive rhomboid protein 2 OS=Mus musculus OX=10090 GN=Rhbdf2 PE=1 SV=1
3	Q96CC6	0.0	1766	855	1.000	1.000	RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2
4	Q76NQ1	1.41e-129	424	1429	0.269	0.161	RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster OX=7227 GN=rho-5 PE=2 SV=1
5	F4JBM4	8.10e-28	119	394	0.075	0.162	RBL4_ARATH RHOMBOID-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=RBL4 PE=2 SV=1
6	Q0WQX7	1.09e-27	118	389	0.082	0.180	RBL1_ARATH RHOMBOID-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBL1 PE=2 SV=1
7	Q9LYP1	1.78e-26	114	346	0.076	0.188	RBL3_ARATH RHOMBOID-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=RBL3 PE=2 SV=1
8	Q9CAN1	3.10e-24	106	317	0.080	0.215	RBL2_ARATH RHOMBOID-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=RBL2 PE=1 SV=1
9	Q8I433	1.26e-21	103	759	0.054	0.061	Q8I433_PLAF7 rhomboid protease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0506900 PE=4 SV=1
10	A0A1D8PFE0	9.62e-19	93.6	669	0.084	0.108	A0A1D8PFE0_CANAL Rbd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RBD1 PE=4 SV=1
11	Q695T8	1.33e-17	89.7	641	0.049	0.066	RHBL4_TOXGO Rhomboid-like protease 4 OS=Toxoplasma gondii OX=5811 GN=ROM4 PE=2 SV=1
12	Q8IIM2	6.37e-13	72.4	278	0.053	0.162	Q8IIM2_PLAF7 rhomboid protease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1114100.1 PE=4 SV=2
13	A0A0H2US45	6.59e-10	62.4	225	0.048	0.182	A0A0H2US45_STRPN Peptidase S54 rhomboid domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_2094 PE=1 SV=1
14	Q9NX52	3.23e-08	58.5	303	0.035	0.099	RHBL2_HUMAN Rhomboid-related protein 2 OS=Homo sapiens OX=9606 GN=RHBDL2 PE=1 SV=2
15	Q9VYW6	5.33e-07	55.5	417	0.046	0.094	Q9VYW6_DROME Rhomboid-4 OS=Drosophila melanogaster OX=7227 GN=rho-4 PE=1 SV=2
16	Q9W0E9	3.89e-06	52.8	485	0.043	0.076	Q9W0E9_DROME Stem cell tumor, isoform B OS=Drosophila melanogaster OX=7227 GN=stet PE=4 SV=2
17	A2AGA4	1.35e-05	50.4	302	0.033	0.093	RHBL2_MOUSE Rhomboid-related protein 2 OS=Mus musculus OX=10090 GN=Rhbdl2 PE=1 SV=1
18	Q19821	1.56e-05	50.4	356	0.051	0.124	RHOM1_CAEEL Rhomboid-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=rom-1 PE=2 SV=2
19	Q9W0F1	2.30e-05	49.7	330	0.043	0.112	Q9W0F1_DROME RE60377p OS=Drosophila melanogaster OX=7227 GN=stet PE=2 SV=2
20	P20350	1.97e-04	47.0	355	0.051	0.124	RHOM_DROME Protein rhomboid OS=Drosophila melanogaster OX=7227 GN=rho PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01694 Rhomboid	2.4e-24	97.5	Rhomboid family
2	PF12595 Rhomboid_SP	9.8e-96	330.3	Rhomboid serine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483814	0.870	GATOR complex protein NPRL3
2	9606.ENSP00000293860	0.852	DNA-directed RNA polymerase III subunit RPC10
3	9606.ENSP00000372482	0.800	Small nuclear ribonucleoprotein U11/U12 subunit 25
4	9606.ENSP00000344206	0.760	Rhomboid-related protein 1
5	9606.ENSP00000309968	0.758	Disintegrin and metalloproteinase domain-containing protein 17
6	9606.ENSP00000325421	0.749	Presenilins-associated rhomboid-like protein, mitochondrial
7	9606.ENSP00000289968	0.735	Rho GTPase-activating protein 17
8	9606.ENSP00000006777	0.709	Rhomboid domain containing 2
9	9606.ENSP00000262370	0.701	E3 ubiquitin-protein ligase MGRN1
10	9606.ENSP00000219660	0.693	Aquaporin-8
11	9606.ENSP00000382021	0.687	Leucine carboxyl methyltransferase 1
12	9606.ENSP00000293872	0.660	Putative RNA-binding protein Luc7-like 1
13	9606.ENSP00000265171	0.655	Pro-epidermal growth factor
14	9606.ENSP00000375914	0.634	Rhomboid-related protein 4
15	9606.ENSP00000382508	0.634	Cell death-inducing p53-target protein 1
16	9606.ENSP00000216085	0.632	Rhomboid domain containing 3
17	9606.ENSP00000383911	0.612	Ubiquitin-associated domain-containing protein 2
18	9606.ENSP00000293230	0.610	Cytoglobin
19	9606.ENSP00000426909	0.599	Receptor of activated protein C kinase 1
20	9606.ENSP00000219406	0.589	Protein disulfide-isomerase A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.484	catalytic activity, acting on a protein
GO:0016787	0.301	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.991	negative regulation of biological process
GO:0009987	0.985	cellular process
GO:0009966	0.977	regulation of signal transduction
GO:0048523	0.923	negative regulation of cellular process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0080090	0.887	regulation of primary metabolic process
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0032880	0.868	regulation of protein localization
GO:1903828	0.829	negative regulation of protein localization
GO:1901184	0.815	regulation of ERBB signaling pathway
GO:0051246	0.809	regulation of protein metabolic process
GO:0051048	0.762	negative regulation of secretion
GO:0009894	0.753	regulation of catabolic process
GO:1903531	0.736	negative regulation of secretion by cell
GO:0042176	0.723	regulation of protein catabolic process
GO:0030162	0.696	regulation of proteolysis
GO:0042058	0.677	regulation of epidermal growth factor receptor signaling pathway
GO:1903050	0.633	regulation of proteolysis involved in protein catabolic process
GO:0051224	0.633	negative regulation of protein transport
GO:0050709	0.561	negative regulation of protein secretion
GO:0061136	0.435	regulation of proteasomal protein catabolic process
GO:0048518	0.347	positive regulation of biological process
GO:0008152	0.325	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0071944	0.958	cell periphery
GO:0005886	0.938	plasma membrane
GO:0098588	0.872	bounding membrane of organelle
GO:0005794	0.799	Golgi apparatus
GO:0031974	0.475	membrane-enclosed lumen
GO:0000139	0.458	Golgi membrane
GO:0070013	0.454	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.301	Hydrolases.

[back to server]