StarFunc result for job id Q96CD2

User Input

>input (204 residues)
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLL
TCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGA
MAEVGTIVDKVKEVLFQHSGFQQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CD2	1.000	1.000	2.519E-45	204	1.000	1.000	Q96CD2.pdb.gz	COAC_HUMAN Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens OX=9606 GN=PPCDC PE=1 SV=2
2	PDB:1qzuA	0.765	0.971	2.006E-28	160	0.775	0.988	1qzuA.pdb.gz	Unusual space-group pseudosymmetry in crystals of human phosphopantothenoylcysteine decarboxylase.
3	AFDB:Q69K55	0.876	0.813	1.649E-27	220	0.422	0.391	Q69K55.pdb.gz	HAL3_ORYSJ Phosphopantothenoylcysteine decarboxylase OS=Oryza sativa subsp. japonica OX=39947 GN=HAL3 PE=1 SV=1
4	AFDB:P94063	0.889	0.902	3.737E-27	201	0.441	0.448	P94063.pdb.gz	HAL3B_ARATH Probable phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana OX=3702 GN=HAL3B PE=2 SV=2
5	AFDB:Q9SWE5	0.890	0.870	6.584E-27	209	0.475	0.464	Q9SWE5.pdb.gz	HAL3A_ARATH Phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana OX=3702 GN=HAL3A PE=1 SV=1
6	AFDB:Q9UTI7	0.861	0.284	1.190E-25	625	0.431	0.141	Q9UTI7.pdb.gz	TYSY_SCHPO Probable thymidylate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC15E1.04 PE=3 SV=1
7	PDB:1e20A	0.826	0.908	2.455E-25	185	0.461	0.508	1e20A.pdb.gz	The X-Ray Structure of the Fmn-Binding Protein Athal3 Provides the Structural Basis for the Activity of a Regulatory Subunit Involved in Signal Transduction
8	AFDB:P36024	0.857	0.321	7.568E-24	562	0.412	0.149	P36024.pdb.gz	SIS2_YEAST Phosphopantothenoylcysteine decarboxylase subunit SIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIS2 PE=1 SV=1
9	AFDB:P36076	0.819	0.305	3.426E-23	571	0.387	0.138	P36076.pdb.gz	CAB3_YEAST Coenzyme A biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB3 PE=1 SV=1
10	AFDB:Q08438	0.830	0.258	5.258E-21	674	0.397	0.120	Q08438.pdb.gz	VHS3_YEAST Phosphopantothenoylcysteine decarboxylase subunit VHS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VHS3 PE=1 SV=1
11	AFDB:P0ABQ0	0.749	0.383	4.819E-17	406	0.289	0.145	P0ABQ0.pdb.gz	COABC_ECOLI Coenzyme A biosynthesis bifunctional protein CoaBC OS=Escherichia coli (strain K12) OX=83333 GN=coaBC PE=1 SV=2
12	AFDB:P9WNZ1	0.804	0.403	5.971E-16	418	0.284	0.139	P9WNZ1.pdb.gz	COABC_MYCTU Coenzyme A biosynthesis bifunctional protein CoaBC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=coaBC PE=1 SV=1
13	PDB:5h75D	0.670	0.613	1.364E-11	225	0.186	0.169	5h75D.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
14	PDB:6jddA	0.578	0.660	2.692E-9	176	0.186	0.216	6jddA.pdb.gz	Convergent evolution of the Cys decarboxylases involved in aminovinyl-cysteine (AviCys) biosynthesis.
15	PDB:4zavA	0.505	0.497	1.549E-6	208	0.172	0.168	4zavA.pdb.gz	UbiX is a flavin prenyltransferase required for bacterial ubiquinone biosynthesis.
16	PDB:2rg1A	0.373	0.433	4.187E-4	168	0.152	0.185	2rg1A.pdb.gz
17	PDB:6vo6D	0.311	0.229	7.855E-4	311	0.147	0.096	6vo6D.pdb.gz	Structural Analysis of Cj1427, an Essential NAD-Dependent Dehydrogenase for the Biosynthesis of the Heptose Residues in the Capsular Polysaccharides ofCampylobacter jejuni.
18	PDB:3b6iA	0.378	0.389	1.010E-3	197	0.157	0.162	3b6iA.pdb.gz	Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
19	PDB:4lafA	0.398	0.394	1.299E-3	207	0.123	0.121	4lafA.pdb.gz	Crystal structure of PnpB complex with FMN
20	PDB:6k0gA	0.275	0.190	1.474E-3	335	0.152	0.093	6k0gA.pdb.gz	Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CD2	3.62e-151	419	204	1.000	1.000	COAC_HUMAN Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens OX=9606 GN=PPCDC PE=1 SV=2
2	Q9SWE5	3.68e-57	181	209	0.456	0.445	HAL3A_ARATH Phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana OX=3702 GN=HAL3A PE=1 SV=1
3	P94063	4.14e-54	173	201	0.441	0.448	HAL3B_ARATH Probable phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana OX=3702 GN=HAL3B PE=2 SV=2
4	Q69K55	1.24e-53	172	220	0.412	0.382	HAL3_ORYSJ Phosphopantothenoylcysteine decarboxylase OS=Oryza sativa subsp. japonica OX=39947 GN=HAL3 PE=1 SV=1
5	Q9UTI7	2.37e-50	174	625	0.436	0.142	TYSY_SCHPO Probable thymidylate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC15E1.04 PE=3 SV=1
6	P36076	1.64e-39	144	571	0.382	0.137	CAB3_YEAST Coenzyme A biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB3 PE=1 SV=1
7	P36024	2.42e-38	140	562	0.392	0.142	SIS2_YEAST Phosphopantothenoylcysteine decarboxylase subunit SIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIS2 PE=1 SV=1
8	Q08438	6.10e-31	120	674	0.289	0.088	VHS3_YEAST Phosphopantothenoylcysteine decarboxylase subunit VHS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VHS3 PE=1 SV=1
9	P0ABQ0	2.21e-17	81.3	406	0.279	0.140	COABC_ECOLI Coenzyme A biosynthesis bifunctional protein CoaBC OS=Escherichia coli (strain K12) OX=83333 GN=coaBC PE=1 SV=2
10	P9WNZ1	1.52e-11	64.7	418	0.294	0.144	COABC_MYCTU Coenzyme A biosynthesis bifunctional protein CoaBC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=coaBC PE=1 SV=1
11	Q9RC23	4.98e-10	58.5	194	0.123	0.129	MRSD_BACSY Mersacidin decarboxylase OS=Bacillus sp. (strain HIL-Y85/54728) OX=69002 GN=mrsD PE=1 SV=1
12	Q8PVV3	0.19	34.3	239	0.181	0.155	DMRX_METMA Dihydromethanopterin reductase (acceptor) OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=dmrX PE=1 SV=1
13	Q57661	1.8	31.2	246	0.152	0.126	DMRX_METJA Dihydromethanopterin reductase (acceptor) OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=dmrX PE=1 SV=1
14	A2QHE3	5.2	30.0	227	0.127	0.115	A2QHE3_ASPNC Flavin prenyltransferase PAD1, mitochondrial OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=PAD1 PE=3 SV=1
15	O15020	6.9	30.0	2390	0.069	0.006	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
16	F6W8M4	7.0	30.0	2390	0.069	0.006	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
17	Q3UGZ4	7.2	30.0	2388	0.069	0.006	Q3UGZ4_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
18	Q68FG2	7.2	30.0	2388	0.069	0.006	Q68FG2_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=1 SV=1
19	Q9QWN8	7.6	30.0	2388	0.069	0.006	SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus OX=10116 GN=Sptbn2 PE=1 SV=2
20	Q6A087	8.1	30.0	1972	0.069	0.007	Q6A087_MOUSE MKIAA0302 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02441 Flavoprotein	1e-47	173.3	Flavoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464814	0.997	Bifunctional coenzyme A synthase
2	9606.ENSP00000361642	0.994	Phosphopantothenate--cysteine ligase
3	9606.ENSP00000302108	0.977	Pantothenate kinase 1
4	9606.ENSP00000313377	0.976	Pantothenate kinase 2, mitochondrial
5	9606.ENSP00000239231	0.965	Pantothenate kinase 3
6	9606.ENSP00000354238	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
7	9606.ENSP00000406261	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
8	9606.ENSP00000315644	0.847	Thymidylate synthase
9	9606.ENSP00000367727	0.762	Pantothenate kinase 4
10	9606.ENSP00000230792	0.738	Peroxisomal NADH pyrophosphatase NUDT12
11	9606.ENSP00000341779	0.736	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
12	9606.ENSP00000469240	0.729	Charged multivesicular body protein 2a
13	9606.ENSP00000308515	0.725	dephospho-CoA kinase domain containing
14	9606.ENSP00000326031	0.705	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
15	9606.ENSP00000378769	0.699	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
16	9606.ENSP00000314806	0.674	Forkhead box R1
17	9606.ENSP00000194530	0.665	STE20-related kinase adapter protein beta
18	9606.ENSP00000300403	0.643	Targeting protein for Xklp2
19	9606.ENSP00000392147	0.627	Protein phosphatase 6 catalytic subunit
20	9606.ENSP00000357882	0.607	L-seryl-tRNA(Sec) kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004633	1.000	phosphopantothenoylcysteine decarboxylase activity
GO:0010181	1.000	FMN binding
GO:0016740	0.349	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:1901135	0.979	carbohydrate derivative metabolic process
GO:0034033	0.978	purine nucleoside bisphosphate biosynthetic process
GO:0033875	0.976	ribonucleoside bisphosphate metabolic process
GO:0009117	0.975	nucleotide metabolic process
GO:0015936	0.973	coenzyme A metabolic process
GO:0034030	0.973	ribonucleoside bisphosphate biosynthetic process
GO:0009152	0.969	purine ribonucleotide biosynthetic process
GO:0015937	0.428	coenzyme A biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.924	membrane-bounded organelle
GO:0043231	0.827	intracellular membrane-bounded organelle
GO:0070013	0.535	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16793	1.000	H(+) + N-[(R)-4-phosphopantothenoyl]-L-cysteine = (R)-4'-phosphopantetheine + CO2
EC:4.1.1.36	1.000	phosphopantothenoylcysteine decarboxylase.
EC:2.-.-.-	0.349	Transferases.

[back to server]