StarFunc result for job id Q96CF2

User Input

>input (233 residues)
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CF2	1.000	1.000	2.995E-31	233	1.000	1.000	Q96CF2.pdb.gz	CHM4C_HUMAN Charged multivesicular body protein 4c OS=Homo sapiens OX=9606 GN=CHMP4C PE=1 SV=1
2	AFDB:D4A9Z8	0.538	0.558	1.572E-20	224	0.609	0.634	D4A9Z8.pdb.gz	D4A9Z8_RAT Chromatin modifying protein 4B-like 1 OS=Rattus norvegicus OX=10116 GN=Chmp4bl1 PE=3 SV=1
3	AFDB:Q6IQ73	0.507	0.526	3.551E-20	224	0.639	0.665	Q6IQ73.pdb.gz	CHM4C_DANRE Charged multivesicular body protein 4c OS=Danio rerio OX=7955 GN=chmp4c PE=2 SV=1
4	AFDB:Q7ZVC4	0.524	0.553	4.285E-20	220	0.635	0.673	Q7ZVC4.pdb.gz	CHM4B_DANRE Charged multivesicular body protein 4b OS=Danio rerio OX=7955 GN=chmp4b PE=2 SV=1
5	AFDB:Q9BY43	0.488	0.510	2.515E-18	222	0.524	0.550	Q9BY43.pdb.gz	CHM4A_HUMAN Charged multivesicular body protein 4a OS=Homo sapiens OX=9606 GN=CHMP4A PE=1 SV=3
6	AFDB:Q18886	0.539	0.566	3.960E-17	221	0.511	0.538	Q18886.pdb.gz	Q18886_CAEEL Charged multivesicular body protein 4b OS=Caenorhabditis elegans OX=6239 GN=vps-32.1 PE=1 SV=1
7	AFDB:Q8T0Q4	0.530	0.546	6.235E-16	226	0.481	0.496	Q8T0Q4.pdb.gz	Q8T0Q4_DROME GH13992p OS=Drosophila melanogaster OX=7227 GN=shrb PE=1 SV=1
8	AFDB:Q9P7F7	0.462	0.484	1.498E-11	222	0.365	0.383	Q9P7F7.pdb.gz	SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf7 PE=3 SV=1
9	AFDB:P39929	0.492	0.479	2.048E-11	240	0.348	0.338	P39929.pdb.gz	SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF7 PE=1 SV=1
10	AFDB:Q5ABD0	0.454	0.467	2.215E-10	226	0.313	0.323	Q5ABD0.pdb.gz	SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF7 PE=3 SV=1
11	PDB:6tz402	0.405	0.518	2.241E-3	176	0.129	0.170	6tz402.pdb.gz
12	PDB:6cnnA	0.243	0.170	1.916E-1	360	0.056	0.036	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
13	PDB:5bw9g	0.273	0.376	3.584E-1	141	0.107	0.177	5bw9g.pdb.gz
14	PDB:6s1kE	0.319	0.677	5.219E-1	102	0.043	0.098	6s1kE.pdb.gz
15	PDB:3favC	0.313	0.740	5.916E-1	90	0.043	0.111	3favC.pdb.gz	WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
16	PDB:6tuyA	0.316	0.112	6.299E-1	667	0.052	0.018	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
17	PDB:1serB	0.284	0.160	7.140E-1	421	0.060	0.033	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
18	PDB:3lssA	0.308	0.166	7.601E-1	438	0.043	0.023	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
19	PDB:3k29A	0.371	0.509	8.093E-1	162	0.099	0.142	3k29A.pdb.gz
20	PDB:6wg3D	0.192	0.062	1.040	932	0.047	0.012	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CF2	8.74e-172	473	233	1.000	1.000	CHM4C_HUMAN Charged multivesicular body protein 4c OS=Homo sapiens OX=9606 GN=CHMP4C PE=1 SV=1
2	Q9D8B3	8.14e-85	253	224	0.631	0.656	CHM4B_MOUSE Charged multivesicular body protein 4b OS=Mus musculus OX=10090 GN=Chmp4b PE=1 SV=2
3	Q9H444	1.13e-84	253	224	0.631	0.656	CHM4B_HUMAN Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1
4	D4A9Z8	1.79e-84	252	224	0.614	0.638	D4A9Z8_RAT Chromatin modifying protein 4B-like 1 OS=Rattus norvegicus OX=10116 GN=Chmp4bl1 PE=3 SV=1
5	Q6IQ73	2.34e-78	236	224	0.609	0.634	CHM4C_DANRE Charged multivesicular body protein 4c OS=Danio rerio OX=7955 GN=chmp4c PE=2 SV=1
6	Q7ZVC4	1.23e-77	234	220	0.558	0.591	CHM4B_DANRE Charged multivesicular body protein 4b OS=Danio rerio OX=7955 GN=chmp4b PE=2 SV=1
7	Q9BY43	2.95e-69	213	222	0.541	0.568	CHM4A_HUMAN Charged multivesicular body protein 4a OS=Homo sapiens OX=9606 GN=CHMP4A PE=1 SV=3
8	Q8T0Q4	3.38e-68	211	226	0.489	0.504	Q8T0Q4_DROME GH13992p OS=Drosophila melanogaster OX=7227 GN=shrb PE=1 SV=1
9	Q18886	1.40e-65	204	221	0.494	0.520	Q18886_CAEEL Charged multivesicular body protein 4b OS=Caenorhabditis elegans OX=6239 GN=vps-32.1 PE=1 SV=1
10	Q9P7F7	8.44e-40	138	222	0.352	0.369	SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf7 PE=3 SV=1
11	P39929	5.96e-26	103	240	0.330	0.321	SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF7 PE=1 SV=1
12	Q5ABD0	7.31e-23	94.7	226	0.240	0.248	SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF7 PE=3 SV=1
13	Q86H98	9.17e-23	94.0	215	0.296	0.321	CHMP4_DICDI Charged multivesicular body protein 4 OS=Dictyostelium discoideum OX=44689 GN=chmp4 PE=3 SV=1
14	Q9SZE4	2.01e-16	77.4	219	0.292	0.311	VP322_ARATH Vacuolar protein sorting-associated protein 32 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS32.2 PE=1 SV=1
15	O82197	5.68e-14	70.5	213	0.292	0.319	VP321_ARATH Vacuolar protein sorting-associated protein 32 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS32.1 PE=1 SV=1
16	Q96FZ7	1.54e-10	60.8	201	0.197	0.229	CHMP6_HUMAN Charged multivesicular body protein 6 OS=Homo sapiens OX=9606 GN=CHMP6 PE=1 SV=3
17	Q8WUX9	1.82e-08	56.2	453	0.236	0.121	CHMP7_HUMAN Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7 PE=1 SV=1
18	Q9W236	3.85e-08	54.3	212	0.215	0.236	Q9W236_DROME Vacuolar protein sorting 20, isoform A OS=Drosophila melanogaster OX=7227 GN=Vps20 PE=1 SV=1
19	Q9LPN5	6.20e-08	53.9	235	0.150	0.149	VP601_ARATH Vacuolar protein sorting-associated protein 60.1 OS=Arabidopsis thaliana OX=3702 GN=VPS60-1 PE=1 SV=1
20	Q9FY89	5.70e-07	50.8	216	0.202	0.218	VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS20.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02582 DUF155	1.4e+02	14.0	RMND1/Sif2-Sif3/Mrx10, DUF155
2	PF03357 Snf7	1.3e-49	179.6	Snf7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411825	0.995	Programmed cell death 6-interacting protein
2	9606.ENSP00000469240	0.980	Charged multivesicular body protein 2a
3	9606.ENSP00000223500	0.971	Charged multivesicular body protein 5
4	9606.ENSP00000217402	0.968	Charged multivesicular body protein 4b
5	9606.ENSP00000254950	0.966	Vacuolar protein sorting-associated protein 4A
6	9606.ENSP00000238497	0.955	Vacuolar protein sorting-associated protein 4B
7	9606.ENSP00000405575	0.942	Charged multivesicular body protein 3
8	9606.ENSP00000474823	0.942	annotation not available
9	9606.ENSP00000380998	0.939	Charged multivesicular body protein 1a
10	9606.ENSP00000432279	0.939	Charged multivesicular body protein 1b
11	9606.ENSP00000438399	0.927	IST1 homolog
12	9606.ENSP00000421380	0.926	Vacuolar-sorting protein SNF8
13	9606.ENSP00000217133	0.924	Tubulin beta-1 chain
14	9606.ENSP00000248437	0.924	Tubulin alpha-4A chain
15	9606.ENSP00000264071	0.924	Tubulin beta-4A chain
16	9606.ENSP00000318197	0.924	Tubulin alpha-3E chain
17	9606.ENSP00000318697	0.924	Tubulin beta-6 chain
18	9606.ENSP00000456206	0.924	Tubulin beta-8 chain
19	9606.ENSP00000253794	0.920	Vacuolar protein-sorting-associated protein 25
20	9606.ENSP00000324205	0.919	Charged multivesicular body protein 4a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.996	metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0051179	0.995	localization
GO:0044237	0.993	cellular metabolic process
GO:0006810	0.989	transport
GO:0006996	0.988	organelle organization
GO:0009056	0.987	catabolic process
GO:0051641	0.987	cellular localization
GO:0044085	0.986	cellular component biogenesis
GO:0019538	0.985	protein metabolic process
GO:0044000	0.982	movement in host
GO:0044248	0.981	cellular catabolic process
GO:0019058	0.980	viral life cycle
GO:0051301	0.978	cell division
GO:0010256	0.978	endomembrane system organization
GO:1903047	0.977	mitotic cell cycle process
GO:0061024	0.976	membrane organization
GO:0051649	0.976	establishment of localization in cell
GO:0000910	0.970	cytokinesis
GO:0044091	0.969	membrane biogenesis
GO:0006998	0.969	nuclear envelope organization
GO:0043162	0.967	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0001778	0.966	plasma membrane repair
GO:0071985	0.963	multivesicular body sorting pathway
GO:0007034	0.958	vacuolar transport
GO:0006914	0.956	autophagy
GO:0019076	0.955	viral release from host cell
GO:0000281	0.952	mitotic cytokinesis
GO:0071709	0.951	membrane assembly
GO:0071763	0.951	nuclear membrane organization
GO:0051128	0.950	regulation of cellular component organization
GO:0016050	0.947	vesicle organization
GO:0032506	0.947	cytokinetic process
GO:0070925	0.946	organelle assembly
GO:1902410	0.944	mitotic cytokinetic process
GO:0051303	0.943	establishment of chromosome localization
GO:0046755	0.941	viral budding
GO:0000819	0.938	sister chromatid segregation
GO:0140014	0.937	mitotic nuclear division
GO:0051310	0.934	metaphase plate congression
GO:0016236	0.931	macroautophagy
GO:0007041	0.927	lysosomal transport
GO:0000070	0.923	mitotic sister chromatid segregation
GO:0022411	0.918	cellular component disassembly
GO:0051726	0.908	regulation of cell cycle
GO:0033043	0.907	regulation of organelle organization
GO:0007032	0.907	endosome organization
GO:0048519	0.894	negative regulation of biological process
GO:0097352	0.890	autophagosome maturation
GO:0032886	0.887	regulation of microtubule-based process
GO:0010564	0.884	regulation of cell cycle process
GO:0048523	0.883	negative regulation of cellular process
GO:1902115	0.879	regulation of organelle assembly
GO:0051493	0.870	regulation of cytoskeleton organization
GO:0090224	0.841	regulation of spindle organization
GO:0007080	0.841	mitotic metaphase plate congression
GO:0060548	0.805	negative regulation of cell death
GO:0060236	0.798	regulation of mitotic spindle organization
GO:0019222	0.465	regulation of metabolic process
GO:0051716	0.381	cellular response to stimulus
GO:0048518	0.363	positive regulation of biological process
GO:0048522	0.337	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0098588	0.996	bounding membrane of organelle
GO:0005770	0.995	late endosome
GO:0032991	0.994	protein-containing complex
GO:0010008	0.992	endosome membrane
GO:0005886	0.991	plasma membrane
GO:0005774	0.986	vacuolar membrane
GO:0030496	0.984	midbody
GO:0098796	0.979	membrane protein complex
GO:0000323	0.979	lytic vacuole
GO:0099512	0.975	supramolecular fiber
GO:0005819	0.975	spindle
GO:0036452	0.972	ESCRT complex
GO:0005694	0.969	chromosome
GO:0099513	0.967	polymeric cytoskeletal fiber
GO:0005771	0.967	multivesicular body
GO:0005764	0.965	lysosome
GO:0005874	0.960	microtubule
GO:0031967	0.959	organelle envelope
GO:0005776	0.951	autophagosome
GO:0098852	0.947	lytic vacuole membrane
GO:0000421	0.943	autophagosome membrane
GO:0005635	0.934	nuclear envelope
GO:0098687	0.931	chromosomal region
GO:0140513	0.928	nuclear protein-containing complex
GO:0000775	0.905	chromosome, centromeric region
GO:0005765	0.900	lysosomal membrane
GO:0000776	0.896	kinetochore
GO:0005643	0.887	nuclear pore
GO:0031902	0.874	late endosome membrane
GO:0005576	0.867	extracellular region
GO:0070062	0.846	extracellular exosome
GO:0005828	0.843	kinetochore microtubule
GO:0032585	0.831	multivesicular body membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]