StarFunc result for job id Q96CG3

User Input

>input (184 residues)
MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTF
QDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFG
EYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMD
ENES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CG3	1.000	1.000	1.189E-35	184	1.000	1.000	Q96CG3.pdb.gz	TIFA_HUMAN TRAF-interacting protein with FHA domain-containing protein A OS=Homo sapiens OX=9606 GN=TIFA PE=1 SV=1
2	AFDB:Q793I8	0.821	0.821	6.730E-29	184	0.766	0.766	Q793I8.pdb.gz	TIFA_MOUSE TRAF-interacting protein with FHA domain-containing protein A OS=Mus musculus OX=10090 GN=Tifa PE=1 SV=1
3	PDB:6l9wD	0.755	0.975	1.312E-23	142	0.603	0.782	6l9wD.pdb.gz
4	AFDB:Q2MHQ9	0.766	0.791	4.245E-22	178	0.457	0.472	Q2MHQ9.pdb.gz	TIFA_XENLA TRAF-interacting protein with FHA domain-containing protein A OS=Xenopus laevis OX=8355 GN=tifa PE=1 SV=1
5	AFDB:Q6ZNK6	0.708	0.806	9.094E-16	161	0.250	0.286	Q6ZNK6.pdb.gz	TIFAB_HUMAN TRAF-interacting protein with FHA domain-containing protein B OS=Homo sapiens OX=9606 GN=TIFAB PE=1 SV=2
6	AFDB:Q8JZM6	0.713	0.886	4.124E-15	147	0.250	0.313	Q8JZM6.pdb.gz	TIFAB_MOUSE TRAF-interacting protein with FHA domain-containing protein B OS=Mus musculus OX=10090 GN=Tifab PE=2 SV=1
7	AFDB:Q9M8A0	0.467	0.163	1.788E-5	585	0.125	0.039	Q9M8A0.pdb.gz	Q9M8A0_ARATH F16B3.3 protein OS=Arabidopsis thaliana OX=3702 GN=FHA3 PE=1 SV=1
8	AFDB:O14270	0.385	0.103	3.417E-5	743	0.185	0.046	O14270.pdb.gz	FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fhl1 PE=3 SV=2
9	AFDB:Q8IQE9	0.366	0.099	5.264E-5	746	0.174	0.043	Q8IQE9.pdb.gz	Q8IQE9_DROME Forkhead box K, isoform G OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=2
10	AFDB:Q55EZ0	0.448	0.319	9.031E-5	268	0.098	0.067	Q55EZ0.pdb.gz	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
11	AFDB:Q9P7G6	0.348	0.123	9.031E-5	566	0.147	0.048	Q9P7G6.pdb.gz	YK42_SCHPO Transcription factor P14E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP14E8.02 PE=1 SV=1
12	PDB:7dvqX	0.384	0.447	3.061E-4	156	0.065	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:5gm6U	0.448	0.466	1.388E-3	176	0.060	0.062	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:2ff4A	0.355	0.178	3.669E-3	379	0.060	0.029	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:2kb3A	0.348	0.440	4.553E-3	143	0.098	0.126	2kb3A.pdb.gz
16	PDB:7wrgA	0.339	0.086	1.756E-2	812	0.049	0.011	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	PDB:5z56X	0.419	0.476	6.416E-2	159	0.076	0.088	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:7wrgB	0.326	0.084	7.544E-2	783	0.049	0.011	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
19	PDB:7po27	0.099	0.049	1.101E-1	571	0.054	0.018	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
20	PDB:2waaA	0.110	0.072	1.606E-1	335	0.076	0.042	2waaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CG3	1.01e-136	380	184	1.000	1.000	TIFA_HUMAN TRAF-interacting protein with FHA domain-containing protein A OS=Homo sapiens OX=9606 GN=TIFA PE=1 SV=1
2	Q793I8	4.49e-100	288	184	0.766	0.766	TIFA_MOUSE TRAF-interacting protein with FHA domain-containing protein A OS=Mus musculus OX=10090 GN=Tifa PE=1 SV=1
3	Q2MHQ9	5.34e-52	166	178	0.462	0.478	TIFA_XENLA TRAF-interacting protein with FHA domain-containing protein A OS=Xenopus laevis OX=8355 GN=tifa PE=1 SV=1
4	Q8JZM6	2.92e-13	65.9	147	0.250	0.313	TIFAB_MOUSE TRAF-interacting protein with FHA domain-containing protein B OS=Mus musculus OX=10090 GN=Tifab PE=2 SV=1
5	Q6ZNK6	2.13e-10	58.5	161	0.223	0.255	TIFAB_HUMAN TRAF-interacting protein with FHA domain-containing protein B OS=Homo sapiens OX=9606 GN=TIFAB PE=1 SV=2
6	M9PC64	0.18	34.7	745	0.147	0.036	M9PC64_DROME Forkhead box K, isoform P OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
7	M9PF47	0.18	34.7	760	0.147	0.036	M9PF47_DROME Forkhead box K, isoform N OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
8	M9PI07	0.18	34.7	745	0.147	0.036	M9PI07_DROME Forkhead box K, isoform O OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
9	Q8IQE9	0.20	34.3	746	0.147	0.036	Q8IQE9_DROME Forkhead box K, isoform G OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=2
10	A0JL24	0.22	34.3	654	0.147	0.041	A0JL24_DROME Fork head transcription factor short isoform OS=Drosophila melanogaster OX=7227 GN=FoxK PE=2 SV=1
11	Q0E8F8	0.22	34.3	740	0.147	0.036	Q0E8F8_DROME Fork head transcription factor long isoform OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
12	Q8N743	1.1	32.0	410	0.120	0.054	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	Q8NI17	5.2	30.0	732	0.103	0.026	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
14	Q9JHP7	6.1	29.6	502	0.065	0.024	PLGT2_MOUSE Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.099	24.3	FHA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354911

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433623	0.996	TNF receptor-associated factor 6
2	9606.ENSP00000272317	0.923	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000304697	0.900	Polyubiquitin-B
4	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
5	9606.ENSP00000441543	0.900	Polyubiquitin-C
6	9606.ENSP00000398048	0.892	Alpha-protein kinase 1
7	9606.ENSP00000247668	0.776	TNF receptor-associated factor 2
8	9606.ENSP00000054668	0.690	Urotensin 2
9	9606.ENSP00000328203	0.639	E3 ubiquitin-protein ligase TRAIP
10	9606.ENSP00000258648	0.614	Mediator of RNA polymerase II transcription subunit 4
11	9606.ENSP00000216160	0.611	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
12	9606.ENSP00000358335	0.607	Mitogen-activated protein kinase kinase kinase 7
13	9606.ENSP00000356426	0.602	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
14	9606.ENSP00000368215	0.602	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
15	9606.ENSP00000367638	0.601	Rho guanine nucleotide exchange factor 39
16	9606.ENSP00000358997	0.526	Interleukin-1 receptor-associated kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0080134	0.988	regulation of response to stress
GO:0050778	0.988	positive regulation of immune response
GO:0043122	0.978	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007165	0.975	signal transduction
GO:0031347	0.973	regulation of defense response
GO:0048522	0.970	positive regulation of cellular process
GO:0002833	0.970	positive regulation of response to biotic stimulus
GO:0032103	0.965	positive regulation of response to external stimulus
GO:0002376	0.953	immune system process
GO:0002253	0.940	activation of immune response
GO:0002764	0.938	immune response-regulating signaling pathway
GO:0045088	0.936	regulation of innate immune response
GO:0043123	0.936	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031349	0.935	positive regulation of defense response
GO:0045089	0.920	positive regulation of innate immune response
GO:0030522	0.912	intracellular receptor signaling pathway
GO:0002758	0.905	innate immune response-activating signaling pathway
GO:0044419	0.903	biological process involved in interspecies interaction between organisms
GO:0002221	0.889	pattern recognition receptor signaling pathway
GO:0006950	0.861	response to stress
GO:0009607	0.859	response to biotic stimulus
GO:0009605	0.842	response to external stimulus
GO:0016043	0.825	cellular component organization
GO:0022607	0.806	cellular component assembly
GO:0043207	0.799	response to external biotic stimulus
GO:0051707	0.788	response to other organism
GO:0051259	0.692	protein complex oligomerization
GO:0006952	0.664	defense response
GO:0051260	0.616	protein homooligomerization
GO:0002753	0.518	cytosolic pattern recognition receptor signaling pathway
GO:0019222	0.470	regulation of metabolic process
GO:0060255	0.404	regulation of macromolecule metabolic process
GO:0098542	0.401	defense response to other organism
GO:0006955	0.368	immune response
GO:0080090	0.326	regulation of primary metabolic process
GO:0051171	0.326	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005634	0.905	nucleus
GO:0070013	0.526	intracellular organelle lumen
GO:0012505	0.502	endomembrane system
GO:0016020	0.461	membrane
GO:0031981	0.427	nuclear lumen
GO:0005654	0.366	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]