StarFunc result for job id Q96CG8

User Input

>input (243 residues)
MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPA
GVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDL
GKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQ
GSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEE
LPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CG08	0.643	0.638	1.139E-35	245	0.955	0.947	Q8CG08.pdb.gz	CTHR1_RAT Collagen triple helix repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cthrc1 PE=1 SV=1
2	AFDB:F1Q7G0	0.625	0.653	2.358E-30	232	0.658	0.690	F1Q7G0.pdb.gz
3	AFDB:O54693	0.342	0.231	2.023E-6	391	0.165	0.102	O54693.pdb.gz	EDA_MOUSE Ectodysplasin-A OS=Mus musculus OX=10090 GN=Eda PE=1 SV=2
4	AFDB:P41274	0.297	0.246	2.245E-6	309	0.144	0.113	P41274.pdb.gz	TNFL9_MOUSE Tumor necrosis factor ligand superfamily member 9 OS=Mus musculus OX=10090 GN=Tnfsf9 PE=1 SV=1
5	AFDB:Q9Y6C2	0.279	0.088	1.319E-5	1016	0.177	0.042	Q9Y6C2.pdb.gz	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
6	AFDB:B0LKN7	0.294	0.264	1.464E-5	280	0.152	0.132	B0LKN7.pdb.gz	B0LKN7_BOVIN B-cell activating factor OS=Bos taurus OX=9913 GN=TNFSF13B PE=2 SV=1
7	AFDB:Q99K41	0.257	0.076	2.221E-5	1017	0.160	0.038	Q99K41.pdb.gz	EMIL1_MOUSE EMILIN-1 OS=Mus musculus OX=10090 GN=Emilin1 PE=1 SV=1
8	AFDB:A0A0U5J7Q1	0.300	0.267	2.340E-5	285	0.156	0.133	A0A0U5J7Q1.pdb.gz	A0A0U5J7Q1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=TNLG7A PE=2 SV=1
9	AFDB:Q9WU72	0.294	0.244	3.036E-5	309	0.169	0.133	Q9WU72.pdb.gz	TN13B_MOUSE Tumor necrosis factor ligand superfamily member 13B OS=Mus musculus OX=10090 GN=Tnfsf13b PE=1 SV=1
10	AFDB:P06804	0.293	0.301	3.370E-5	235	0.128	0.132	P06804.pdb.gz	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
11	PDB:5h4bA	0.316	0.486	1.776E-3	136	0.066	0.118	5h4bA.pdb.gz
12	PDB:1js9C	0.207	0.244	2.839E-3	189	0.099	0.127	1js9C.pdb.gz
13	PDB:7drtB	0.248	0.150	2.839E-3	496	0.058	0.028	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
14	PDB:2waaA	0.192	0.150	4.779E-3	335	0.062	0.045	2waaA.pdb.gz
15	PDB:5kc6B	0.237	0.347	5.304E-3	144	0.066	0.111	5kc6B.pdb.gz
16	PDB:3fxiC	0.191	0.259	8.476E-3	140	0.049	0.086	3fxiC.pdb.gz
17	PDB:7rslA	0.218	0.225	1.044E-2	235	0.082	0.085	7rslA.pdb.gz
18	PDB:4tlgA	0.160	0.117	1.286E-2	396	0.058	0.035	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:2e31A	0.204	0.202	1.668E-2	246	0.074	0.073	2e31A.pdb.gz
20	PDB:3lxuX	0.240	0.067	1.757E-2	1217	0.049	0.010	3lxuX.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CG8	5.24e-180	495	243	1.000	1.000	CTHR1_HUMAN Collagen triple helix repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=CTHRC1 PE=1 SV=1
2	Q8CG08	1.30e-159	444	245	0.947	0.939	CTHR1_RAT Collagen triple helix repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cthrc1 PE=1 SV=1
3	Q9D1D6	1.16e-157	439	245	0.938	0.931	CTHR1_MOUSE Collagen triple helix repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Cthrc1 PE=2 SV=2
4	Q6AXL0	3.64e-123	351	231	0.704	0.740	Q6AXL0_DANRE Collagen triple helix repeat containing 1a OS=Danio rerio OX=7955 GN=zgc:101075 PE=2 SV=1
5	Q6FY13	5.77e-05	46.2	794	0.082	0.025	Q6FY13_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A01870g PE=3 SV=1
6	A0A8I6AHL9	6.51e-04	43.1	3316	0.082	0.006	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
7	O62432	0.001	41.6	289	0.086	0.073	O62432_CAEEL Nematode cuticle collagen N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-4 PE=1 SV=1
8	Q6DBS9	0.004	39.7	242	0.074	0.074	Q6DBS9_DANRE Complement component 1, q subcomponent, B chain precursor OS=Danio rerio OX=7955 GN=zgc:91810 PE=2 SV=1
9	D3ZDS2	0.005	40.0	509	0.086	0.041	D3ZDS2_RAT Macrophage scavenger receptor 1 OS=Rattus norvegicus OX=10116 GN=Msr1 PE=1 SV=3
10	F1SKM1	0.008	39.7	2938	0.086	0.007	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
11	O17642	0.008	39.3	283	0.086	0.074	O17642_CAEEL Nematode cuticle collagen N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=col-179 PE=1 SV=1
12	E9PWQ3	0.009	39.7	3284	0.078	0.006	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
13	Q2UY09	0.009	39.7	1125	0.078	0.017	COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2
14	Q2UY11	0.009	39.7	1141	0.078	0.017	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
15	Q0VF58	0.010	39.3	1136	0.091	0.019	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
16	Q9UEW3	0.010	39.3	520	0.082	0.038	MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens OX=9606 GN=MARCO PE=1 SV=1
17	A0A087WS16	0.011	39.3	2677	0.078	0.007	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
18	J3QQ16	0.011	39.3	2677	0.078	0.007	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
19	Q8K299	0.011	38.9	491	0.078	0.039	SCAR5_MOUSE Scavenger receptor class A member 5 OS=Mus musculus OX=10090 GN=Scara5 PE=1 SV=1
20	O88493	0.013	39.3	2657	0.078	0.007	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	0.0046	28.0	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008093

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008099	0.803	Frizzled class receptor 6
2	60711.ENSCSAP00000012510	0.692	Ligand for members of the frizzled family of seven transmembrane receptors
3	60711.ENSCSAP00000017322	0.688	Dishevelled segment polarity protein 1
4	60711.ENSCSAP00000003528	0.687	Uncharacterized protein
5	60711.ENSCSAP00000008116	0.667	Dishevelled segment polarity protein 2
6	60711.ENSCSAP00000007812	0.663	Belongs to the protein kinase superfamily. Tyr protein kinase family
7	60711.ENSCSAP00000014445	0.658	Netrin 4
8	60711.ENSCSAP00000011986	0.649	Frizzled class receptor 3
9	60711.ENSCSAP00000018291	0.647	Frizzled class receptor 5
10	60711.ENSCSAP00000009718	0.645	Dishevelled segment polarity protein 3
11	60711.ENSCSAP00000018988	0.636	Frizzled class receptor 9
12	60711.ENSCSAP00000009988	0.569	Prolyl 4-hydroxylase, alpha polypeptide II
13	60711.ENSCSAP00000016670	0.567	Receptor tyrosine kinase-like orphan receptor 1
14	60711.ENSCSAP00000008080	0.557	DDB1 and CUL4 associated factor 13
15	60711.ENSCSAP00000000117	0.553	Ligand for members of the frizzled family of seven transmembrane receptors
16	60711.ENSCSAP00000018288	0.550	Frizzled class receptor 7
17	60711.ENSCSAP00000007569	0.539	Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2
18	60711.ENSCSAP00000009056	0.519	Ligand for members of the frizzled family of seven transmembrane receptors
19	60711.ENSCSAP00000007106	0.517	Ligand for members of the frizzled family of seven transmembrane receptors
20	60711.ENSCSAP00000004723	0.516	Leucine zipper protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	0.999	Wnt-protein binding
GO:0005109	0.998	frizzled binding
GO:0042802	0.533	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.972	biological regulation
GO:0032501	0.956	multicellular organismal process
GO:0007275	0.949	multicellular organism development
GO:0050789	0.933	regulation of biological process
GO:0050794	0.922	regulation of cellular process
GO:0050896	0.878	response to stimulus
GO:0048518	0.839	positive regulation of biological process
GO:0009653	0.834	anatomical structure morphogenesis
GO:0048522	0.775	positive regulation of cellular process
GO:0048731	0.729	system development
GO:0007154	0.727	cell communication
GO:0009888	0.709	tissue development
GO:0048519	0.708	negative regulation of biological process
GO:0023052	0.702	signaling
GO:0051716	0.599	cellular response to stimulus
GO:0071840	0.592	cellular component organization or biogenesis
GO:0016477	0.592	cell migration
GO:0007165	0.576	signal transduction
GO:0048583	0.569	regulation of response to stimulus
GO:0048523	0.553	negative regulation of cellular process
GO:0016043	0.546	cellular component organization
GO:0023051	0.540	regulation of signaling
GO:0010646	0.532	regulation of cell communication
GO:0050793	0.528	regulation of developmental process
GO:0009790	0.507	embryo development
GO:0007166	0.506	cell surface receptor signaling pathway
GO:0009966	0.455	regulation of signal transduction
GO:0007267	0.452	cell-cell signaling
GO:0007399	0.415	nervous system development
GO:0060429	0.412	epithelium development
GO:0019222	0.399	regulation of metabolic process
GO:0048598	0.398	embryonic morphogenesis
GO:0060255	0.365	regulation of macromolecule metabolic process
GO:0051171	0.335	regulation of nitrogen compound metabolic process
GO:0031323	0.335	regulation of cellular metabolic process
GO:0065009	0.329	regulation of molecular function
GO:1905114	0.326	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0010468	0.306	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0030312	0.999	external encapsulating structure
GO:0005615	0.990	extracellular space
GO:0031012	0.989	extracellular matrix
GO:0005737	0.979	cytoplasm
GO:0012505	0.951	endomembrane system
GO:0062023	0.950	collagen-containing extracellular matrix
GO:0043226	0.815	organelle
GO:0043227	0.810	membrane-bounded organelle
GO:0043229	0.805	intracellular organelle
GO:0043231	0.788	intracellular membrane-bounded organelle
GO:0016020	0.755	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]