StarFunc result for job id Q96CJ1

User Input

>input (260 residues)
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVT
ITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKI
QYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSS
DSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGL
LMNTLRNDLQLSESGSDSDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CJ1	1.000	1.000	6.298E-43	260	1.000	1.000	Q96CJ1.pdb.gz	EAF2_HUMAN ELL-associated factor 2 OS=Homo sapiens OX=9606 GN=EAF2 PE=1 SV=1
2	AFDB:Q91ZD6	0.504	0.500	1.744E-32	262	0.785	0.779	Q91ZD6.pdb.gz	EAF2_MOUSE ELL-associated factor 2 OS=Mus musculus OX=10090 GN=Eaf2 PE=1 SV=1
3	AFDB:Q6IQU8	0.475	0.476	1.181E-28	259	0.654	0.656	Q6IQU8.pdb.gz	Q6IQU8_DANRE ELL-associated factor 2 OS=Danio rerio OX=7955 GN=wu:fb76c01 PE=2 SV=1
4	AFDB:Q6IQD2	0.463	0.475	1.483E-26	253	0.550	0.565	Q6IQD2.pdb.gz	Q6IQD2_DANRE ELL-associated factor 1 OS=Danio rerio OX=7955 GN=wu:fb52f06 PE=2 SV=1
5	AFDB:Q96JC9	0.460	0.447	1.673E-26	268	0.558	0.541	Q96JC9.pdb.gz	EAF1_HUMAN ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1 PE=1 SV=1
6	PDB:7okxO	0.383	0.893	3.208E-15	106	0.300	0.736	7okxO.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
7	AFDB:Q9TXQ9	0.379	0.391	1.057E-12	251	0.288	0.299	Q9TXQ9.pdb.gz	Q9TXQ9_CAEEL Ell-associated factor Eaf OS=Caenorhabditis elegans OX=6239 GN=eaf-1 PE=1 SV=2
8	AFDB:Q7JRJ1	0.411	0.218	1.258E-11	504	0.296	0.153	Q7JRJ1.pdb.gz	EAF_DROME Ell-associated factor Eaf OS=Drosophila melanogaster OX=7227 GN=Eaf PE=1 SV=1
9	AFDB:A0ZWU1	0.397	0.410	4.213E-11	251	0.200	0.207	A0ZWU1.pdb.gz	EAF1_SCHPO Ell1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eaf1 PE=1 SV=1
10	PDB:7ae1M	0.256	0.177	1.065E-4	400	0.104	0.068	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
11	AFDB:P38351	0.222	0.145	1.353E-4	445	0.138	0.081	P38351.pdb.gz	PAF1_YEAST RNA polymerase II-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAF1 PE=1 SV=1
12	AFDB:Q9SU25	0.286	0.133	2.331E-4	649	0.135	0.054	Q9SU25.pdb.gz	T2FA_ARATH Transcription initiation factor IIF subunit alpha OS=Arabidopsis thaliana OX=3702 GN=RAP74 PE=1 SV=1
13	PDB:6eu0M	0.319	0.405	6.140E-4	197	0.077	0.102	6eu0M.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
14	PDB:7ob9M	0.237	0.170	6.928E-4	388	0.073	0.049	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
15	PDB:5fywR	0.255	0.325	8.822E-4	199	0.096	0.126	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
16	PDB:7o4iR	0.268	0.261	1.193E-3	268	0.092	0.090	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:5iy6S	0.310	0.525	1.430E-3	138	0.077	0.145	5iy6S.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
18	PDB:6eu1M	0.307	0.443	1.935E-3	172	0.073	0.110	6eu1M.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
19	PDB:6o9lT	0.254	0.273	2.319E-3	237	0.077	0.084	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
20	PDB:6o9lS	0.283	0.385	2.617E-3	176	0.081	0.119	6o9lS.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CJ1	0.0	535	260	1.000	1.000	EAF2_HUMAN ELL-associated factor 2 OS=Homo sapiens OX=9606 GN=EAF2 PE=1 SV=1
2	Q91ZD6	2.26e-120	346	262	0.754	0.748	EAF2_MOUSE ELL-associated factor 2 OS=Mus musculus OX=10090 GN=Eaf2 PE=1 SV=1
3	Q6IQU8	3.80e-93	276	259	0.650	0.653	Q6IQU8_DANRE ELL-associated factor 2 OS=Danio rerio OX=7955 GN=wu:fb76c01 PE=2 SV=1
4	Q6IQD2	2.86e-78	238	253	0.554	0.569	Q6IQD2_DANRE ELL-associated factor 1 OS=Danio rerio OX=7955 GN=wu:fb52f06 PE=2 SV=1
5	Q96JC9	5.01e-75	231	268	0.577	0.560	EAF1_HUMAN ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1 PE=1 SV=1
6	Q7JRJ1	3.38e-28	114	504	0.223	0.115	EAF_DROME Ell-associated factor Eaf OS=Drosophila melanogaster OX=7227 GN=Eaf PE=1 SV=1
7	Q9TXQ9	6.57e-18	82.4	251	0.177	0.183	Q9TXQ9_CAEEL Ell-associated factor Eaf OS=Caenorhabditis elegans OX=6239 GN=eaf-1 PE=1 SV=2
8	A0ZWU1	0.026	37.7	251	0.104	0.108	EAF1_SCHPO Ell1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eaf1 PE=1 SV=1
9	Q3MV14	2.6	31.6	386	0.150	0.101	DSE1_ARATH Protein DECREASED SIZE EXCLUSION LIMIT 1 OS=Arabidopsis thaliana OX=3702 GN=DSE1 PE=1 SV=1
10	R9PY70	5.0	31.2	2139	0.119	0.014	R9PY70_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
11	M9PDE6	5.1	31.2	2190	0.119	0.014	M9PDE6_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
12	Q9V9N7	6.5	30.8	1710	0.119	0.018	Q9V9N7_DROME GH01875p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG42748 PE=1 SV=2
13	M9PBG0	6.9	30.8	1717	0.119	0.018	M9PBG0_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=CG15217 PE=1 SV=1
14	A8DZ24	7.1	30.8	1639	0.119	0.019	A8DZ24_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG15216 PE=4 SV=1
15	M9PDL8	7.2	30.8	1636	0.119	0.019	M9PDL8_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG15216 PE=4 SV=1
16	Q6PZD9	7.8	30.0	281	0.081	0.075	CEBPE_MOUSE CCAAT/enhancer-binding protein epsilon OS=Mus musculus OX=10090 GN=Cebpe PE=1 SV=1
17	P00897	7.9	30.4	519	0.054	0.027	TRPE_SERMA Anthranilate synthase component 1 OS=Serratia marcescens OX=615 GN=trpE PE=1 SV=2
18	A1A278	8.5	30.4	1002	0.104	0.027	MANA_BIFAA Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15272 BBP1_C	6.9e+02	11.4	Spindle pole body component BBP1, C-terminal
2	PF09816 EAF	5.2e-19	79.8	RNA polymerase II transcription elongation factor
3	PF03353 Lin-8	7.6e+02	11.0	Ras-mediated vulval-induction antagonist
4	PF08277 PAN_3	8.7e+02	11.2	PAN-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262809	0.995	RNA polymerase II elongation factor ELL
2	9606.ENSP00000265343	0.978	AF4/FMR2 family member 4
3	9606.ENSP00000380054	0.967	ELL-associated factor 1
4	9606.ENSP00000320346	0.902	RNA polymerase II elongation factor ELL3
5	9606.ENSP00000326806	0.900	Nuclear cap-binding protein subunit 2
6	9606.ENSP00000364289	0.900	Nuclear cap-binding protein subunit 1
7	9606.ENSP00000428426	0.879	Transcription elongation factor A protein 1
8	9606.ENSP00000252674	0.849	Protein ENL
9	9606.ENSP00000369695	0.838	Protein AF-9
10	9606.ENSP00000237853	0.814	RNA polymerase II elongation factor ELL2
11	9606.ENSP00000295321	0.805	Protein IWS1 homolog
12	9606.ENSP00000319104	0.804	Transcription elongation factor SPT6
13	9606.ENSP00000484525	0.804	RNA polymerase II subunit A C-terminal domain phosphatase
14	9606.ENSP00000480158	0.694	DNA-directed RNA polymerase II subunit RPB1
15	9606.ENSP00000362361	0.677	Cyclin-dependent kinase 9
16	9606.ENSP00000256474	0.666	Von Hippel-Lindau disease tumor suppressor
17	9606.ENSP00000470252	0.661	Transcription elongation factor SPT5
18	9606.ENSP00000261900	0.653	Cyclin-T1
19	9606.ENSP00000264157	0.653	Cyclin-T2
20	9606.ENSP00000328232	0.649	Elongin-A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.915	transcription regulator activity
GO:0003711	0.660	transcription elongation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.994	regulation of RNA metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0032784	0.981	regulation of DNA-templated transcription elongation
GO:0034243	0.951	regulation of transcription elongation by RNA polymerase II
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0051173	0.905	positive regulation of nitrogen compound metabolic process
GO:0051254	0.895	positive regulation of RNA metabolic process
GO:0009987	0.878	cellular process
GO:0006357	0.861	regulation of transcription by RNA polymerase II
GO:0045893	0.853	positive regulation of DNA-templated transcription
GO:0045944	0.724	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:0008023	0.989	transcription elongation factor complex
GO:0005737	0.389	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]