StarFunc result for job id Q96CK0

User Input

>input (615 residues)
MAERALEPEAEAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKKYDVRRV
YLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNV
NCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDS
DPDSDKVGNGLVAGSSDSSSSGSASDSEESPEGQPVKAAAAAAAATPTSPVGSSGLITQE
GVHIPFDVHHVESLAEQGTPLCSNPAGNGPEALETVVCVPVPVQVGAGPSALFENVPQEA
LGEVVASCPMPGMVPGSQVIIIAGPGYDALTAEGIHLNMAAGSGVPGSGLGEEVPCAMME
GVAAYTQTEPEGSQPSTMDATAVAGIETKKEKEDLCLLKKEEKEEPVAPELATTVPESAE
PEAEADGEELDGSDMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQVYVA
LSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSFKRK
NHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKLDS
VKFHTLKSHPDHKPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CK0	1.000	1.000	2.425E-102	615	1.000	1.000	Q96CK0.pdb.gz	ZN653_HUMAN Zinc finger protein 653 OS=Homo sapiens OX=9606 GN=ZNF653 PE=1 SV=1
2	AFDB:O75626	0.179	0.136	3.054E-11	825	0.166	0.124	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
3	AFDB:Q9UFB7	0.131	0.109	6.821E-11	747	0.197	0.162	Q9UFB7.pdb.gz	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
4	AFDB:M9PD94	0.171	0.118	3.403E-10	907	0.151	0.103	M9PD94.pdb.gz	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
5	AFDB:Q5BIH1	0.135	0.104	1.102E-9	803	0.140	0.107	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
6	AFDB:F1R5N6	0.141	0.122	2.461E-9	718	0.176	0.150	F1R5N6.pdb.gz	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
7	AFDB:Q96JB3	0.126	0.126	5.497E-9	615	0.176	0.176	Q96JB3.pdb.gz	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
8	AFDB:A0A5K4F1D0	0.136	0.034	1.549E-7	2566	0.140	0.034	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
9	AFDB:Q09838	0.144	0.131	1.191E-6	681	0.148	0.134	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
10	AFDB:Q5B154	0.140	0.119	3.408E-6	730	0.167	0.141	Q5B154.pdb.gz	Q5B154_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05726 PE=4 SV=1
11	PDB:3w5kB	0.081	0.265	1.313E-3	110	0.054	0.300	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hlqI	0.048	0.198	2.846E-1	111	0.023	0.126	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
13	PDB:5zwmv	0.051	0.138	3.876E-1	174	0.029	0.103	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
14	PDB:2mm3A	0.052	0.196	4.964E-1	127	0.011	0.055	2mm3A.pdb.gz	Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
15	PDB:3s5wB	0.053	0.074	4.964E-1	414	0.008	0.012	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
16	PDB:4girB	0.042	0.059	5.975E-1	411	0.008	0.012	4girB.pdb.gz	crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)
17	PDB:5mp9M	0.058	0.079	5.975E-1	381	0.026	0.042	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:4rerA	0.045	0.055	6.356E-1	459	0.031	0.041	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6msgF	0.049	0.071	6.762E-1	395	0.026	0.041	6msgF.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
20	PDB:1vhzA	0.052	0.153	8.659E-1	186	0.010	0.032	1vhzA.pdb.gz	Structural analysis of a set of proteins resulting from a bacterial genomics project

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CK0	0.0	1270	615	1.000	1.000	ZN653_HUMAN Zinc finger protein 653 OS=Homo sapiens OX=9606 GN=ZNF653 PE=1 SV=1
2	Q96JP5	4.91e-45	170	570	0.122	0.132	ZFP91_HUMAN E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1
3	Q8N554	1.07e-44	170	614	0.119	0.119	ZN276_HUMAN Zinc finger protein 276 OS=Homo sapiens OX=9606 GN=ZNF276 PE=1 SV=4
4	Q9BU19	3.63e-43	164	519	0.137	0.162	ZN692_HUMAN Zinc finger protein 692 OS=Homo sapiens OX=9606 GN=ZNF692 PE=1 SV=1
5	Q86VK4	2.49e-22	102	478	0.089	0.115	ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens OX=9606 GN=ZNF410 PE=1 SV=2
6	G5EDE1	1.25e-21	98.6	336	0.094	0.173	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
7	Q9UFB7	1.42e-20	98.6	747	0.089	0.074	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
8	Q9Y2D9	1.99e-20	97.8	606	0.091	0.092	ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3
9	Q9H116	4.19e-20	97.1	711	0.091	0.079	GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens OX=9606 GN=GZF1 PE=1 SV=1
10	Q96JL9	4.73e-20	96.7	665	0.080	0.074	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
11	O88553	1.14e-19	95.5	601	0.086	0.088	ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus OX=10116 GN=Zfp37 PE=1 SV=1
12	Q8BGV5	1.57e-19	94.7	572	0.088	0.094	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
13	Q4VBD9	1.74e-19	95.1	706	0.089	0.078	GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus OX=10090 GN=Gzf1 PE=1 SV=2
14	X2JCQ6	2.19e-19	95.1	822	0.099	0.074	X2JCQ6_DROME Metal response element-binding transcription Factor-1, isoform F OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
15	P17141	2.72e-19	94.0	594	0.068	0.071	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
16	A8JNP3	2.78e-19	94.7	1006	0.099	0.061	A8JNP3_DROME Metal response element-binding transcription Factor-1, isoform C OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
17	P17098	3.30e-19	94.0	575	0.088	0.094	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
18	Q15973	4.61e-19	91.3	351	0.091	0.160	ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens OX=9606 GN=ZNF124 PE=1 SV=2
19	Q9UEG4	4.69e-19	94.0	869	0.089	0.063	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
20	Q60821	8.32e-19	93.2	794	0.085	0.065	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	2.4e+02	13.6	FOXP coiled-coil domain
2	PF00096 zf-C2H2	2.6e-12	57.6	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	3.8e-05	35.2	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	4.3	18.7	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	78	15.0	Zinc-finger double-stranded RNA-binding
6	PF05605 zf-Di19	50	15.6	Drought induced 19 protein (Di19), zinc-binding
7	PF13465 zf-H2C2_2	8.9e-12	56.1	Zinc-finger double domain
8	PF12874 zf-met	85	15.0	Zinc-finger of C2H2 type
9	PF09723 Zn-ribbon_8	2.9	19.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326095	0.776	E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates . In turn, participates in different biological processes including interferon production or autophagy . Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6 . Plays also a role in the early recruitment of autophagy adapters to bacteria . Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication
2	9606.ENSP00000356331	0.744	Nuclear receptor subfamily 5 group A member 2
3	9606.ENSP00000330432	0.672	Protein FAM83F
4	9606.ENSP00000356814	0.671	DDB1- and CUL4-associated factor 6
5	9606.ENSP00000362690	0.658	Steroidogenic factor 1
6	9606.ENSP00000354340	0.653	NEDD8-activating enzyme E1 catalytic subunit
7	9606.ENSP00000298832	0.635	Tubulin polyglutamylase TTLL5
8	9606.ENSP00000368592	0.634	Inactive polyglycylase TTLL10
9	9606.ENSP00000399968	0.629	Nuclear receptor coactivator 2
10	9606.ENSP00000251250	0.611	DTW domain containing 1
11	9606.ENSP00000351990	0.590	NEDD8-activating enzyme E1 regulatory subunit
12	9606.ENSP00000328551	0.573	Ras-related protein Rab-28
13	9606.ENSP00000398131	0.571	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
14	9606.ENSP00000385216	0.549	Nuclear receptor coactivator 1
15	9606.ENSP00000482032	0.505	Inositol hexakisphosphate kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	1.000	transcription coregulator activity
GO:0019904	1.000	protein domain specific binding
GO:0140297	0.996	DNA-binding transcription factor binding
GO:0003714	0.989	transcription corepressor activity
GO:1901363	0.829	heterocyclic compound binding
GO:0097159	0.829	organic cyclic compound binding
GO:0003676	0.783	nucleic acid binding
GO:0003677	0.758	DNA binding
GO:0043565	0.619	sequence-specific DNA binding
GO:0003690	0.595	double-stranded DNA binding
GO:0000976	0.546	transcription cis-regulatory region binding
GO:0050682	0.529	AF-2 domain binding
GO:0003700	0.516	DNA-binding transcription factor activity
GO:0000981	0.470	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.967	regulation of primary metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.935	regulation of biosynthetic process
GO:0010556	0.932	regulation of macromolecule biosynthetic process
GO:0031326	0.932	regulation of cellular biosynthetic process
GO:0051252	0.916	regulation of RNA metabolic process
GO:1903506	0.914	regulation of nucleic acid-templated transcription
GO:0048523	0.824	negative regulation of cellular process
GO:0010605	0.796	negative regulation of macromolecule metabolic process
GO:0010468	0.770	regulation of gene expression
GO:0006355	0.731	regulation of DNA-templated transcription
GO:0051172	0.715	negative regulation of nitrogen compound metabolic process
GO:1903507	0.528	negative regulation of nucleic acid-templated transcription
GO:0048583	0.523	regulation of response to stimulus
GO:0023051	0.423	regulation of signaling
GO:0010646	0.423	regulation of cell communication
GO:0048518	0.417	positive regulation of biological process
GO:0009966	0.408	regulation of signal transduction
GO:0048522	0.387	positive regulation of cellular process
GO:0010648	0.376	negative regulation of cell communication
GO:0006357	0.372	regulation of transcription by RNA polymerase II
GO:0023057	0.361	negative regulation of signaling
GO:0008152	0.342	metabolic process
GO:0048585	0.342	negative regulation of response to stimulus
GO:0009987	0.337	cellular process
GO:0009968	0.326	negative regulation of signal transduction
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process
GO:0031325	0.311	positive regulation of cellular metabolic process
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.987	nuclear lumen
GO:0005654	0.968	nucleoplasm
GO:0005737	0.817	cytoplasm
GO:0043232	0.766	intracellular non-membrane-bounded organelle
GO:0005829	0.471	cytosol
GO:0032991	0.434	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]