StarFunc result for job id Q96CM3

User Input

>input (377 residues)
MAAPRWSASGPWIRGNGQGCGSLFTLVSKPFCAAAAASTAINAQRLAEKLRAQKREQDTK
KEPVSTNAVQRRVQEIVRFTRQLQRVHPNVLAKALTRGILHQDKNLVVINKPYGLPVHGG
PGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQ
VVKKYWAITVHVPMPSAGVVDIPIVEKEAQGQQQHHKMTLSPSYRMDDGKMVKVRRSRNA
QVAVTQYQVLSSTLSSALVELQPITGIKHQLRVHLSFGLDCPILGDHKYSDWNRLAPQKL
SVGTLKKLGLEQSKARYIPLHLHARQLILPALGSGKEELNLVCKLPRFFVHSLHRLRLEM
PNEDQNENNEAKCLGAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CM3	1.000	1.000	6.091E-76	377	1.000	1.000	Q96CM3.pdb.gz	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
2	AFDB:Q9CWX4	0.805	0.805	1.213E-62	377	0.785	0.785	Q9CWX4.pdb.gz	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
3	AFDB:Q6P087	0.630	0.674	4.182E-24	351	0.249	0.268	Q6P087.pdb.gz	RUSD3_HUMAN Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3
4	AFDB:Q9LT72	0.565	0.450	3.751E-22	477	0.220	0.174	Q9LT72.pdb.gz	PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g19440 PE=2 SV=1
5	AFDB:Q5XET6	0.527	0.421	6.459E-21	478	0.204	0.161	Q5XET6.pdb.gz	PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g78910 PE=2 SV=1
6	AFDB:Q38FJ3	0.591	0.551	7.662E-21	406	0.175	0.163	Q38FJ3.pdb.gz	Q38FJ3_TRYB2 Pseudouridylate synthase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2000 PE=1 SV=1
7	AFDB:P0AA39	0.544	0.638	8.110E-21	319	0.191	0.226	P0AA39.pdb.gz	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
8	PDB:6yxxEC	0.577	0.583	7.594E-20	373	0.175	0.177	6yxxEC.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
9	AFDB:Q3ECD0	0.515	0.454	1.024E-18	430	0.191	0.167	Q3ECD0.pdb.gz	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
10	AFDB:P0AA37	0.479	0.801	2.852E-18	219	0.172	0.297	P0AA37.pdb.gz	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
11	AFDB:P0AA41	0.500	0.709	5.039E-18	260	0.196	0.285	P0AA41.pdb.gz	TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=truC PE=1 SV=1
12	PDB:2i82A	0.466	0.787	5.744E-18	217	0.178	0.309	2i82A.pdb.gz	Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure
13	PDB:2istA	0.516	0.599	1.793E-17	321	0.178	0.209	2istA.pdb.gz
14	PDB:2olwA	0.261	0.508	6.274E-6	179	0.064	0.134	2olwA.pdb.gz
15	PDB:1kskA	0.258	0.392	1.436E-4	234	0.093	0.150	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
16	PDB:2rfkA	0.281	0.313	1.609E-4	334	0.106	0.120	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
17	PDB:3dh3B	0.255	0.379	1.609E-4	241	0.077	0.120	3dh3B.pdb.gz	Crystal structure of an RluF-RNA complex: a base-pair rearrangement is the key to selectivity of RluF for U2604 of the ribosome.
18	PDB:7v9aC	0.261	0.252	4.745E-4	393	0.072	0.069	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
19	PDB:1sgvB	0.217	0.293	1.481E-3	266	0.069	0.098	1sgvB.pdb.gz
20	PDB:2v9kA	0.277	0.231	3.286E-3	467	0.061	0.049	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CM3	0.0	779	377	1.000	1.000	RUSD4_HUMAN Pseudouridylate synthase RPUSD4, mitochondrial OS=Homo sapiens OX=9606 GN=RPUSD4 PE=1 SV=1
2	Q9CWX4	0.0	575	377	0.785	0.785	RUSD4_MOUSE Pseudouridylate synthase RPUSD4, mitochondrial OS=Mus musculus OX=10090 GN=Rpusd4 PE=2 SV=1
3	Q9LT72	6.61e-24	104	477	0.215	0.170	PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g19440 PE=2 SV=1
4	Q5XET6	7.28e-21	95.9	478	0.228	0.180	PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g78910 PE=2 SV=1
5	Q38FJ3	8.69e-20	92.4	406	0.191	0.177	Q38FJ3_TRYB2 Pseudouridylate synthase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2000 PE=1 SV=1
6	Q6P087	3.01e-17	84.3	351	0.228	0.245	RUSD3_HUMAN Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3
7	Q12362	5.76e-17	84.7	591	0.186	0.118	RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIB2 PE=1 SV=1
8	P0AA39	7.86e-17	82.8	319	0.159	0.188	RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=rluC PE=1 SV=1
9	P53294	3.47e-16	81.6	404	0.175	0.163	PUS6_YEAST tRNA pseudouridine(31) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS6 PE=1 SV=1
10	P0AA41	2.11e-15	77.4	260	0.167	0.242	TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) OX=83333 GN=truC PE=1 SV=1
11	Q12069	2.47e-15	79.3	462	0.159	0.130	PUS9_YEAST tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS9 PE=1 SV=1
12	P0AA37	3.09e-14	73.6	219	0.170	0.292	RLUA_ECOLI Dual-specificity RNA pseudouridine synthase RluA OS=Escherichia coli (strain K12) OX=83333 GN=rluA PE=1 SV=2
13	Q8IZ73	1.13e-13	74.7	545	0.194	0.134	RUSD2_HUMAN Pseudouridylate synthase RPUSD2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2
14	Q09709	3.30e-13	72.4	394	0.154	0.147	YA32_SCHPO Pseudouridylate synthase C18B11.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18B11.02c PE=3 SV=1
15	M9MRH0	2.62e-12	70.5	543	0.178	0.123	M9MRH0_DROME RluA pseudouridine synthase 2, isoform C OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=1
16	Q9VKU8	2.80e-12	70.1	547	0.178	0.122	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
17	Q3ECD0	2.20e-11	67.0	430	0.167	0.147	PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g76050 PE=2 SV=1
18	P33643	1.02e-10	64.7	326	0.159	0.184	RLUD_ECOLI Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli (strain K12) OX=83333 GN=rluD PE=1 SV=4
19	F4KBV6	4.57e-10	63.2	410	0.156	0.144	F4KBV6_ARATH Pseudouridine synthase OS=Arabidopsis thaliana OX=3702 GN=MWD22.8 PE=1 SV=1
20	O25114	3.17e-07	53.9	298	0.172	0.218	Y347_HELPY Uncharacterized RNA pseudouridine synthase HP_0347 OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0347 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00849 PseudoU_synth_2	1.9e-31	120.8	RNA pseudouridylate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332340	0.896	Probable ATP-dependent RNA helicase DDX28
2	9606.ENSP00000361982	0.880	Mitochondrial mRNA pseudouridine synthase TRUB2
3	9606.ENSP00000368389	0.843	Neugrin
4	9606.ENSP00000306080	0.833	rRNA methyltransferase 3, mitochondrial
5	9606.ENSP00000481559	0.796	rRNA methyltransferase 1, mitochondrial
6	9606.ENSP00000236980	0.780	FAST kinase domain-containing protein 2, mitochondrial
7	9606.ENSP00000365837	0.776	tRNA pseudouridine synthase A
8	9606.ENSP00000348722	0.741	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
9	9606.ENSP00000415899	0.741	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs
10	9606.ENSP00000419740	0.729	5-methylcytosine rRNA methyltransferase NSUN4
11	9606.ENSP00000480364	0.723	RCC1-like G exchanging factor-like protein
12	9606.ENSP00000222511	0.691	GTP-binding protein 10
13	9606.ENSP00000302801	0.687	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
14	9606.ENSP00000227474	0.686	tRNA pseudouridine(38/39) synthase
15	9606.ENSP00000351644	0.686	tRNA modification GTPase GTPBP3, mitochondrial
16	9606.ENSP00000368318	0.686	Pseudouridylate synthase-like 1
17	9606.ENSP00000242257	0.679	rRNA methyltransferase 2, mitochondrial
18	9606.ENSP00000356134	0.677	Dimethyladenosine transferase 1, mitochondrial
19	9606.ENSP00000417602	0.676	Belongs to the universal ribosomal protein uL29 family.
20	9606.ENSP00000359859	0.673	Mitochondrial ribosome-associated GTPase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0009982	1.000	pseudouridine synthase activity
GO:0000049	1.000	tRNA binding
GO:0070180	1.000	large ribosomal subunit rRNA binding
GO:1990400	0.716	mitochondrial ribosomal large subunit rRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016556	0.989	mRNA modification
GO:0000963	0.986	mitochondrial RNA processing
GO:0006400	0.986	tRNA modification
GO:0050789	0.980	regulation of biological process
GO:1900864	0.975	mitochondrial RNA modification
GO:0045727	0.957	positive regulation of translation
GO:0062125	0.952	regulation of mitochondrial gene expression
GO:0001522	0.952	pseudouridine synthesis
GO:0070129	0.930	regulation of mitochondrial translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031981	0.992	nuclear lumen
GO:0005654	0.970	nucleoplasm
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0099080	0.691	supramolecular complex
GO:0035770	0.527	ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	1.000	Intramolecular transferases.

[back to server]