StarFunc result for job id Q96CM8

User Input

>input (615 residues)
MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSY
VQGCTKKHLNSKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIG
LCKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQ
FKTQQYYNVLKQICPEVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQ
HLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQ
LRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERGTFLYGTPTMF
VDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH
FPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTE
EAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQV
VGVKDDRMGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKI
QKFKLREQMERHLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VCW8	0.924	0.924	0.000	615	0.785	0.785	Q8VCW8.pdb.gz	ACSF2_MOUSE Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Mus musculus OX=10090 GN=Acsf2 PE=1 SV=1
2	AFDB:Q96CM8	1.000	1.000	0.000	615	1.000	1.000	Q96CM8.pdb.gz	ACSF2_HUMAN Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Homo sapiens OX=9606 GN=ACSF2 PE=1 SV=2
3	AFDB:Q9UAV8	0.893	0.881	5.680E-80	623	0.413	0.408	Q9UAV8.pdb.gz	Q9UAV8_CAEEL Acyl-CoA synthetase family member 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acs-1 PE=1 SV=1
4	AFDB:O18693	0.889	0.885	5.765E-77	618	0.382	0.380	O18693.pdb.gz	O18693_CAEEL AMP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acs-2 PE=1 SV=1
5	AFDB:Q9VMR6	0.878	0.910	1.575E-71	593	0.363	0.376	Q9VMR6.pdb.gz	Q9VMR6_DROME Acyl-CoA synthetase family member 2 OS=Drosophila melanogaster OX=7227 GN=Acsf2 PE=1 SV=1
6	AFDB:Q4WR83	0.807	0.839	5.449E-65	590	0.325	0.339	Q4WR83.pdb.gz	SIDI_ASPFU Acyl-CoA ligase sidI OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sidI PE=2 SV=1
7	AFDB:P38135	0.646	0.699	1.641E-51	566	0.272	0.295	P38135.pdb.gz	FADK_ECOLI Medium-chain fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadK PE=1 SV=4
8	AFDB:Q9S777	0.783	0.855	1.476E-49	561	0.231	0.253	Q9S777.pdb.gz	4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana OX=3702 GN=4CL3 PE=1 SV=1
9	AFDB:Q9VXZ8	0.817	0.840	1.476E-49	597	0.244	0.251	Q9VXZ8.pdb.gz	Q9VXZ8_DROME BcDNA.GH02901 OS=Drosophila melanogaster OX=7227 GN=pdgy PE=1 SV=2
10	AFDB:P69451	0.747	0.814	3.937E-49	561	0.255	0.280	P69451.pdb.gz	LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadD PE=1 SV=1
11	PDB:6q2mA	0.769	0.864	1.018E-48	544	0.221	0.250	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
12	PDB:3r44A	0.608	0.731	9.205E-46	502	0.226	0.277	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
13	PDB:5bsmA	0.757	0.874	8.242E-45	530	0.221	0.257	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
14	PDB:7kydA	0.766	0.877	1.165E-44	534	0.210	0.242	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
15	PDB:5ie2A	0.727	0.877	8.775E-44	506	0.252	0.306	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
16	PDB:1ultA	0.636	0.725	5.247E-43	533	0.234	0.270	1ultA.pdb.gz
17	PDB:3rg2C	0.618	0.619	5.697E-38	613	0.185	0.186	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
18	PDB:3b7wA	0.614	0.696	1.206E-37	537	0.211	0.242	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
19	PDB:2p20A	0.621	0.597	9.082E-37	641	0.190	0.183	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
20	PDB:1ry2A	0.730	0.730	1.534E-35	615	0.180	0.180	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VCW8	0.0	1017	615	0.787	0.787	ACSF2_MOUSE Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Mus musculus OX=10090 GN=Acsf2 PE=1 SV=1
2	Q96CM8	0.0	1283	615	1.000	1.000	ACSF2_HUMAN Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Homo sapiens OX=9606 GN=ACSF2 PE=1 SV=2
3	Q9UAV8	5.61e-172	504	623	0.408	0.403	Q9UAV8_CAEEL Acyl-CoA synthetase family member 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acs-1 PE=1 SV=1
4	O18693	5.77e-154	458	618	0.382	0.380	O18693_CAEEL AMP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acs-2 PE=1 SV=1
5	Q9VMR6	2.60e-147	440	593	0.369	0.383	Q9VMR6_DROME Acyl-CoA synthetase family member 2 OS=Drosophila melanogaster OX=7227 GN=Acsf2 PE=1 SV=1
6	Q4WR83	3.66e-109	342	590	0.320	0.334	SIDI_ASPFU Acyl-CoA ligase sidI OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sidI PE=2 SV=1
7	Q9EY88	2.82e-66	226	491	0.265	0.332	FCS_AMYSP Feruloyl-CoA synthase OS=Amycolatopsis sp. OX=37632 GN=fcs PE=1 SV=1
8	S5M744	2.82e-66	226	491	0.265	0.332	FCS_STRSQ Feruloyl-CoA synthase OS=Streptomyces sp. OX=1931 GN=fcs PE=1 SV=2
9	P38135	2.06e-65	226	566	0.267	0.290	FADK_ECOLI Medium-chain fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadK PE=1 SV=4
10	P69451	1.73e-63	221	561	0.270	0.296	LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadD PE=1 SV=1
11	P9WQ37	2.49e-63	219	503	0.249	0.304	FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD13 PE=1 SV=1
12	F4HUK6	1.61e-55	199	556	0.246	0.272	AAE1_ARATH Butanoate--CoA ligase AAE1 OS=Arabidopsis thaliana OX=3702 GN=AAE1 PE=1 SV=1
13	Q9HYU4	4.92e-52	189	562	0.265	0.290	Q9HYU4_PSEAE Long-chain-fatty-acid--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=fadD1 PE=4 SV=1
14	Q9S725	1.12e-49	183	556	0.242	0.268	4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana OX=3702 GN=4CL2 PE=1 SV=2
15	Q6ETN3	2.00e-49	182	554	0.226	0.251	4CL3_ORYSJ 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=4CL3 PE=1 SV=1
16	Q9S777	2.14e-49	182	561	0.234	0.257	4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana OX=3702 GN=4CL3 PE=1 SV=1
17	I3PB37	2.45e-48	179	544	0.233	0.263	4CL1_PETHY 4-coumarate:CoA ligase 1 OS=Petunia hybrida OX=4102 GN=4CL1 PE=1 SV=1
18	Q42982	3.88e-48	179	569	0.236	0.255	4CL2_ORYSJ 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=4CL2 PE=1 SV=2
19	Q9SMT7	2.69e-47	176	514	0.262	0.313	4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE3 PE=1 SV=1
20	Q5LRT0	5.00e-47	175	539	0.234	0.267	DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=dmdB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	5.1e-93	323.6	AMP-binding enzyme
2	PF13193 AMP-binding_C	1.3e-13	63.0	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000015964

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000009412	0.873	Acyl-CoA dehydrogenase, C-2 to C-3 short chain
2	9598.ENSPTRP00000045478	0.873	Acyl-CoA dehydrogenase, short/branched chain
3	9598.ENSPTRP00000009272	0.860	Acyl-CoA dehydrogenase family member 10
4	9598.ENSPTRP00000027397	0.807	Belongs to the acyl-CoA oxidase family.
5	9598.ENSPTRP00000000776	0.774	Uncharacterized protein
6	9598.ENSPTRP00000032963	0.692	Uncharacterized protein
7	9598.ENSPTRP00000034421	0.688	Epoxide hydrolase 2, cytoplasmic
8	9598.ENSPTRP00000031683	0.679	alpha-1,2-Mannosidase
9	9598.ENSPTRP00000028143	0.666	Uncharacterized protein
10	9598.ENSPTRP00000036394	0.653	Uncharacterized protein
11	9598.ENSPTRP00000004002	0.649	Rho GTPase activating protein 21
12	9598.ENSPTRP00000020159	0.646	Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (Trifunctional protein), alpha subunit
13	9598.ENSPTRP00000025446	0.642	Acetyl-CoA acyltransferase 1
14	9598.ENSPTRP00000058647	0.638	Pan troglodytes hydroxysteroid dehydrogenase like 2 (HSDL2), mRNA
15	9598.ENSPTRP00000018990	0.633	Uncharacterized protein
16	9598.ENSPTRP00000053469	0.633	Uncharacterized protein
17	9598.ENSPTRP00000015140	0.631	Aldehyde dehydrogenase 3 family, member A2
18	9598.ENSPTRP00000026466	0.630	Acyl-CoA dehydrogenase family, member 9
19	9598.ENSPTRP00000053157	0.630	acyl-CoA dehydrogenase, very long chain
20	9598.ENSPTRP00000026543	0.626	Acyl-CoA dehydrogenase family, member 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016405	1.000	CoA-ligase activity
GO:0015645	1.000	fatty acid ligase activity
GO:0005515	0.999	protein binding
GO:0004467	0.990	long-chain fatty acid-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044281	0.993	small molecule metabolic process
GO:0019637	0.987	organophosphate metabolic process
GO:0034032	0.980	purine nucleoside bisphosphate metabolic process
GO:0009259	0.976	ribonucleotide metabolic process
GO:0033875	0.973	ribonucleoside bisphosphate metabolic process
GO:0009150	0.967	purine ribonucleotide metabolic process
GO:0043603	0.909	amide metabolic process
GO:0006790	0.785	sulfur compound metabolic process
GO:0006637	0.736	acyl-CoA metabolic process
GO:0006629	0.417	lipid metabolic process
GO:0006631	0.334	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.926	mitochondrial matrix
GO:0016020	0.592	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.990	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.990	long-chain-fatty-acid--CoA ligase.

[back to server]