StarFunc result for job id Q96CQ1

User Input

>input (311 residues)
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVV
SPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQV
HMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGM
SASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCA
TTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMA
TYELVVYLLNG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q922G0	0.961	0.961	4.159E-38	311	0.961	0.961	Q922G0.pdb.gz	S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus OX=10090 GN=Slc25a36 PE=2 SV=1
2	AFDB:Q9BSK2	0.901	0.874	1.290E-28	321	0.598	0.579	Q9BSK2.pdb.gz	S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens OX=9606 GN=SLC25A33 PE=1 SV=1
3	AFDB:Q9VQ37	0.906	0.774	1.153E-26	365	0.559	0.477	Q9VQ37.pdb.gz	RIM2_DROME Mitochondrial carrier protein Rim2 OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=2 SV=2
4	AFDB:P38127	0.848	0.707	1.518E-20	377	0.408	0.337	P38127.pdb.gz	RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM2 PE=1 SV=1
5	AFDB:Q59TD1	0.835	0.657	4.141E-20	399	0.434	0.338	Q59TD1.pdb.gz	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
6	AFDB:O22261	0.817	0.815	1.943E-17	312	0.305	0.304	O22261.pdb.gz	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
7	AFDB:Q8RWA5	0.813	0.701	2.029E-17	363	0.312	0.267	Q8RWA5.pdb.gz	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
8	AFDB:P40556	0.827	0.694	3.578E-17	373	0.299	0.249	P40556.pdb.gz	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
9	AFDB:P39953	0.797	0.743	4.260E-17	335	0.289	0.269	P39953.pdb.gz	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
10	AFDB:Q9UTD6	0.742	0.630	2.904E-16	371	0.322	0.270	Q9UTD6.pdb.gz	YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.03c PE=3 SV=1
11	PDB:4c9qB	0.670	0.715	6.233E-11	290	0.215	0.231	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.670	0.708	9.642E-11	293	0.215	0.229	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.495	0.521	3.706E-6	292	0.235	0.250	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.521	0.540	3.037E-4	297	0.222	0.232	2lckA.pdb.gz
15	PDB:5mkkB	0.204	0.137	7.405E-2	577	0.106	0.057	5mkkB.pdb.gz
16	PDB:3qf4B	0.143	0.095	2.302E-1	588	0.154	0.082	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
17	PDB:7ehlA	0.165	0.110	2.991E-1	563	0.113	0.062	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
18	PDB:7p5cA	0.126	0.109	3.263E-1	392	0.158	0.125	7p5cA.pdb.gz
19	PDB:5nbdA	0.163	0.109	3.409E-1	564	0.129	0.071	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
20	PDB:5mkkA	0.220	0.151	6.558E-1	593	0.129	0.067	5mkkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q922G0	0.0	619	311	0.961	0.961	S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus OX=10090 GN=Slc25a36 PE=2 SV=1
2	Q96CQ1	0.0	645	311	1.000	1.000	S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens OX=9606 GN=SLC25A36 PE=1 SV=1
3	Q3TZX3	1.41e-136	391	320	0.605	0.588	S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus OX=10090 GN=Slc25a33 PE=2 SV=1
4	Q9BSK2	2.45e-136	390	321	0.605	0.586	S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens OX=9606 GN=SLC25A33 PE=1 SV=1
5	M9ND06	2.03e-110	326	358	0.569	0.494	M9ND06_DROME Replication in mitochondria 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
6	Q9VQ37	1.16e-108	322	365	0.569	0.485	RIM2_DROME Mitochondrial carrier protein Rim2 OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=2 SV=2
7	M9NDD0	6.14e-96	286	272	0.457	0.522	M9NDD0_DROME Replication in mitochondria 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Rim2 PE=3 SV=1
8	Q59TD1	1.86e-75	238	399	0.447	0.348	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
9	P38127	1.26e-59	197	377	0.421	0.347	RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM2 PE=1 SV=1
10	P40556	4.98e-46	161	373	0.315	0.263	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
11	P39953	2.70e-44	155	335	0.299	0.278	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
12	Q8RWA5	5.83e-41	147	363	0.312	0.267	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
13	Q6IZB5	1.90e-36	134	316	0.315	0.310	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
14	O22261	1.97e-36	134	312	0.286	0.285	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
15	Q8BMG8	1.45e-35	132	316	0.296	0.291	S2532_MOUSE Solute carrier family 25 member 32 OS=Mus musculus OX=10090 GN=Slc25a32 PE=1 SV=1
16	Q9H2D1	2.98e-35	131	315	0.296	0.292	S2532_HUMAN Solute carrier family 25 member 32 OS=Homo sapiens OX=9606 GN=SLC25A32 PE=1 SV=2
17	Q9UTD6	1.17e-33	128	371	0.325	0.272	YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.03c PE=3 SV=1
18	P40464	8.86e-32	122	311	0.267	0.267	FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLX1 PE=3 SV=1
19	Q12482	1.33e-31	126	902	0.270	0.093	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
20	Q7XA87	1.60e-31	121	308	0.267	0.269	FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FOLT1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	3.5e-65	227.3	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479504	0.813	Probable ATP-dependent RNA helicase DDX52
2	9606.ENSP00000454836	0.751	Transducin beta-like protein 3
3	9606.ENSP00000460871	0.740	Ribosomal L1 domain-containing protein 1
4	9606.ENSP00000273963	0.736	Kelch-like protein 8
5	9606.ENSP00000346725	0.734	Pescadillo homolog
6	9606.ENSP00000483495	0.725	Probable ATP-dependent RNA helicase DDX27
7	9606.ENSP00000348161	0.712	Probable G-protein coupled receptor 160
8	9606.ENSP00000258772	0.694	Probable ATP-dependent RNA helicase DDX56
9	9606.ENSP00000262146	0.674	Mitochondrial fission regulator 1
10	9606.ENSP00000363746	0.668	WD repeat-containing protein 46
11	9606.ENSP00000374633	0.666	Putative interleukin-17 receptor E-like
12	9606.ENSP00000199320	0.664	Probable dimethyladenosine transferase
13	9606.ENSP00000232888	0.663	U3 small nucleolar RNA-interacting protein 2
14	9606.ENSP00000317992	0.653	Nucleolar complex protein 2 homolog
15	9606.ENSP00000363642	0.653	Ribosome biogenesis protein BMS1 homolog
16	9606.ENSP00000238146	0.652	ATP-dependent RNA helicase DDX55
17	9606.ENSP00000348596	0.652	Protein SDA1 homolog
18	9606.ENSP00000396673	0.650	pre-rRNA processing protein FTSJ3
19	9606.ENSP00000405068	0.650	Nucleolar protein 14
20	9606.ENSP00000360412	0.645	Nucleolar complex protein 3 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015215	1.000	nucleotide transmembrane transporter activity
GO:0008514	0.933	organic anion transmembrane transporter activity
GO:0005488	0.902	binding
GO:0005515	0.780	protein binding
GO:1901702	0.560	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.992	biological regulation
GO:0015931	0.992	nucleobase-containing compound transport
GO:0071840	0.883	cellular component organization or biogenesis
GO:0016043	0.817	cellular component organization
GO:0042391	0.814	regulation of membrane potential
GO:0007005	0.748	mitochondrion organization
GO:0051881	0.727	regulation of mitochondrial membrane potential
GO:0015748	0.727	organophosphate ester transport
GO:0000002	0.726	mitochondrial genome maintenance
GO:0050789	0.626	regulation of biological process
GO:0006862	0.568	nucleotide transport
GO:0050794	0.545	regulation of cellular process
GO:0008152	0.510	metabolic process
GO:0071704	0.453	organic substance metabolic process
GO:0044237	0.360	cellular metabolic process
GO:0044238	0.355	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.461	intracellular organelle lumen
GO:0043232	0.398	intracellular non-membrane-bounded organelle
GO:0031981	0.396	nuclear lumen
GO:0005654	0.387	nucleoplasm
GO:0016020	0.367	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]