StarFunc result for job id Q96CU9

User Input

>input (486 residues)
MIRRVLPHGMGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGRSCDLLQDTSHLP
PEHSDVVIVGGGVLGLSVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFS
LPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQ
EGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQ
GEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAA
LAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYL
GGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKI
QENNII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CU9	1.000	1.000	0.000	486	1.000	1.000	Q96CU9.pdb.gz	FXRD1_HUMAN FAD-dependent oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FOXRED1 PE=1 SV=2
2	AFDB:Q3TQB2	0.957	0.955	5.957E-90	487	0.794	0.793	Q3TQB2.pdb.gz	FXRD1_MOUSE FAD-dependent oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Foxred1 PE=1 SV=1
3	AFDB:Q5JFG7	0.704	0.877	8.449E-34	386	0.222	0.280	Q5JFG7.pdb.gz	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
4	AFDB:Q9UL12	0.680	0.372	3.086E-27	918	0.187	0.099	Q9UL12.pdb.gz	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
5	AFDB:Q64380	0.683	0.372	5.764E-27	919	0.185	0.098	Q64380.pdb.gz	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
6	AFDB:Q8IGS5	0.675	0.373	6.835E-27	907	0.204	0.109	Q8IGS5.pdb.gz	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
7	AFDB:Q5L2C2	0.670	0.848	1.351E-26	377	0.193	0.249	Q5L2C2.pdb.gz	GLYOX_GEOKA Glycine oxidase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=thiO PE=1 SV=1
8	AFDB:Q9DBT9	0.664	0.383	4.209E-26	869	0.195	0.109	Q9DBT9.pdb.gz	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
9	AFDB:Q9UI17	0.668	0.387	4.209E-26	866	0.202	0.113	Q9UI17.pdb.gz	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
10	AFDB:Q9HTE8	0.708	0.821	6.265E-26	416	0.183	0.214	Q9HTE8.pdb.gz	Q9HTE8_PSEAE Sarcosine oxidase beta subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxB PE=4 SV=1
11	PDB:4pabB	0.659	0.398	9.471E-26	824	0.175	0.103	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
12	PDB:4yshA	0.661	0.851	2.704E-24	370	0.187	0.246	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
13	PDB:3nycA	0.618	0.772	1.149E-22	381	0.185	0.236	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
14	PDB:3if9A	0.620	0.809	1.810E-22	364	0.152	0.203	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
15	PDB:2uzzB	0.633	0.810	3.994E-20	372	0.148	0.194	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
16	PDB:5oc2A	0.551	0.600	2.735E-15	441	0.152	0.168	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.
17	PDB:2du8A	0.522	0.713	3.147E-14	340	0.126	0.179	2du8A.pdb.gz	Crystal structure of human D-amino acid oxidase: Context-dependent variability of the backbone conformation of the VAAGL hydrophobic stretch located at the si-face of the flavin ring
18	PDB:4yjdA	0.520	0.714	6.586E-14	342	0.130	0.184	4yjdA.pdb.gz	Crystal structure of DAAO variant
19	PDB:3awiD	0.573	0.436	1.459E-13	659	0.119	0.088	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
20	PDB:2qcuB	0.518	0.504	1.226E-11	501	0.115	0.112	2qcuB.pdb.gz	Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TQB2	0.0	805	487	0.794	0.793	FXRD1_MOUSE FAD-dependent oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Foxred1 PE=1 SV=1
2	Q96CU9	0.0	1003	486	1.000	1.000	FXRD1_HUMAN FAD-dependent oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FOXRED1 PE=1 SV=2
3	Q5JFG7	7.17e-21	96.7	386	0.195	0.246	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
4	Q8IGS5	4.42e-11	67.8	907	0.208	0.111	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
5	Q63342	8.08e-11	67.0	857	0.220	0.125	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
6	Q9DBT9	1.48e-10	66.2	869	0.222	0.124	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
7	A1ZAZ2	1.77e-10	65.9	894	0.206	0.112	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1
8	Q99LB7	3.77e-10	64.7	919	0.193	0.102	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
9	Q9HXE3	4.89e-10	63.5	375	0.183	0.237	DAUA_PSEAE FAD-dependent catabolic D-arginine dehydrogenase DauA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dauA PE=1 SV=1
10	Q64380	1.89e-09	62.8	919	0.189	0.100	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
11	O96023	4.15e-09	60.8	475	0.189	0.194	O96023_HUMAN Dimethylglycine dehydrogenase-like protein isoform 2 OS=Homo sapiens OX=9606 PE=2 SV=1
12	Q9UI17	4.50e-09	61.2	866	0.204	0.114	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
13	Q9UL12	1.28e-08	60.1	918	0.189	0.100	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
14	Q9P0Z9	1.86e-07	55.5	390	0.198	0.246	SOX_HUMAN Peroxisomal sarcosine oxidase OS=Homo sapiens OX=9606 GN=PIPOX PE=1 SV=2
15	Q9UTM9	1.07e-06	53.1	433	0.175	0.196	FAP2_SCHPO L-saccharopine oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap2 PE=1 SV=1
16	Q8TCC6	8.42e-06	50.8	613	0.150	0.119	Q8TCC6_HUMAN DMGDH protein (Fragment) OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=1
17	Q8NCN5	1.33e-05	50.4	879	0.179	0.099	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
18	Q7TSQ8	6.35e-05	48.1	878	0.185	0.103	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
19	Q9D826	7.82e-05	47.4	390	0.047	0.059	SOX_MOUSE Peroxisomal sarcosine oxidase OS=Mus musculus OX=10090 GN=Pipox PE=1 SV=1
20	Q9UL11	8.17e-05	47.0	328	0.115	0.171	Q9UL11_HUMAN Uncharacterized protein SARDH (Fragment) OS=Homo sapiens OX=9606 GN=SARDH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	5.9e-53	192.3	FAD dependent oxidoreductase
2	PF00890 FAD_binding_2	0.51	21.0	FAD binding domain
3	PF01494 FAD_binding_3	1.4e+02	13.2	FAD binding domain
4	PF00633 HHH	2e+02	13.3	Helix-hairpin-helix motif
5	PF06039 Mqo	2.5e+02	11.6	Malate:quinone oxidoreductase (Mqo)
6	PF13450 NAD_binding_8	4.9	18.8	NAD(P)-binding Rossmann-like domain
7	PF00070 Pyr_redox	24	16.8	Pyridine nucleotide-disulphide oxidoreductase
8	PF07992 Pyr_redox_2	2.9	18.6	Pyridine nucleotide-disulphide oxidoreductase
9	PF01946 Thi4	7.7	17.3	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260361	0.957	Complex I intermediate-associated protein 30, mitochondrial
2	9606.ENSP00000362060	0.954	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
3	9606.ENSP00000263774	0.908	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
4	9606.ENSP00000356972	0.908	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
5	9606.ENSP00000392709	0.899	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
6	9606.ENSP00000233627	0.894	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
7	9606.ENSP00000296684	0.891	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
8	9606.ENSP00000315774	0.888	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
9	9606.ENSP00000322450	0.886	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
10	9606.ENSP00000252102	0.884	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
11	9606.ENSP00000360492	0.870	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
12	9606.ENSP00000389160	0.867	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
13	9606.ENSP00000354813	0.864	NADH-ubiquinone oxidoreductase chain 5
14	9606.ENSP00000355206	0.864	NADH-ubiquinone oxidoreductase chain 3
15	9606.ENSP00000252711	0.862	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
16	9606.ENSP00000355046	0.858	NADH-ubiquinone oxidoreductase chain 2
17	9606.ENSP00000237889	0.853	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
18	9606.ENSP00000268668	0.853	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
19	9606.ENSP00000266544	0.844	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
20	9606.ENSP00000354961	0.844	NADH-ubiquinone oxidoreductase chain 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016645	0.998	oxidoreductase activity, acting on the CH-NH group of donors
GO:0005515	0.996	protein binding
GO:1901363	0.735	heterocyclic compound binding
GO:0097159	0.733	organic cyclic compound binding
GO:0050660	0.707	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032981	0.997	mitochondrial respiratory chain complex I assembly
GO:0008152	0.487	metabolic process
GO:0044237	0.418	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.975	membrane
GO:0005743	0.966	mitochondrial inner membrane
GO:0032991	0.964	protein-containing complex
GO:0098798	0.900	mitochondrial protein-containing complex
GO:1902494	0.899	catalytic complex
GO:0098796	0.858	membrane protein complex
GO:0098803	0.841	respiratory chain complex
GO:0098800	0.836	inner mitochondrial membrane protein complex
GO:0005746	0.832	mitochondrial respirasome
GO:0045271	0.825	respiratory chain complex I
GO:0005747	0.821	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.-.-	0.998	Acting on the CH-NH group of donors.

[back to server]