StarFunc result for job id Q96CX3

User Input

>input (271 residues)
MNSSQISLRMKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFR
KQSNLTQHLRIHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPS
LIKHQRIHTGEKPYKCTECGKAFSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQH
QRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEKTFRKQAHLSEHYRIH
TGEKPYECVGCGKSFRHSSALLRHQRLHAGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96CX3	1.000	1.000	7.178E-50	271	1.000	1.000	Q96CX3.pdb.gz	ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens OX=9606 GN=ZNF501 PE=2 SV=2
2	AFDB:Q8TBZ5	0.463	0.234	2.086E-38	544	0.742	0.369	Q8TBZ5.pdb.gz	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
3	AFDB:P52742	0.748	0.337	7.065E-36	658	0.613	0.252	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
4	AFDB:Q6ZN57	0.682	0.437	2.106E-35	461	0.590	0.347	Q6ZN57.pdb.gz	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
5	AFDB:Q8NF99	0.606	0.352	4.362E-35	534	0.572	0.290	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
6	AFDB:Q9NQZ8	0.698	0.422	6.277E-35	489	0.557	0.309	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
7	AFDB:Q8IZ26	0.687	0.368	8.002E-35	560	0.576	0.279	Q8IZ26.pdb.gz	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
8	AFDB:P15620	0.652	0.344	8.502E-35	580	0.583	0.272	P15620.pdb.gz	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
9	AFDB:Q9P0L1	0.451	0.211	1.300E-34	754	0.583	0.210	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
10	AFDB:Q6PK81	0.855	0.537	1.657E-34	442	0.535	0.328	Q6PK81.pdb.gz	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
11	PDB:3w5kB	0.148	0.274	6.945E-5	110	0.144	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.110	0.248	4.600E-1	96	0.059	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:6ydhA	0.060	0.197	5.519E-1	62	0.059	0.258	6ydhA.pdb.gz
14	PDB:4kfzB	0.098	0.153	7.942E-1	148	0.092	0.169	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
15	PDB:1keuA	0.102	0.088	8.439E-1	361	0.089	0.066	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
16	PDB:7pmkQ	0.091	0.047	8.439E-1	766	0.118	0.042	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:5lj5t	0.077	0.051	8.967E-1	438	0.059	0.037	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	PDB:7uhyC	0.073	0.038	9.528E-1	578	0.066	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:4wa6D	0.094	0.064	1.012	415	0.077	0.051	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
20	PDB:4z4kA	0.098	0.095	1.012	282	0.052	0.050	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96CX3	0.0	549	271	1.000	1.000	ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens OX=9606 GN=ZNF501 PE=2 SV=2
2	Q8TBZ5	3.26e-139	404	544	0.745	0.371	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
3	Q15937	1.21e-115	343	498	0.616	0.335	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
4	P52742	2.34e-115	347	658	0.631	0.260	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
5	Q6ZN57	5.61e-115	340	461	0.609	0.358	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
6	A0A0C4DG42	7.37e-113	337	539	0.590	0.297	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
7	Q8IZ26	1.15e-112	337	560	0.590	0.286	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
8	P15620	1.31e-112	337	580	0.598	0.279	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
9	Q9P0L1	2.08e-111	339	754	0.598	0.215	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
10	Q8NA42	1.58e-110	329	475	0.594	0.339	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
11	Q8BLE1	3.80e-110	323	338	0.579	0.464	Q8BLE1_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
12	P51522	9.46e-110	328	516	0.587	0.308	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
13	P17020	1.05e-109	333	682	0.590	0.235	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
14	Q9NQZ8	1.35e-109	327	489	0.587	0.325	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
15	Q8NF99	1.06e-108	326	534	0.572	0.290	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
16	F8WEZ9	1.28e-108	325	492	0.568	0.313	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
17	P17036	2.36e-108	322	446	0.561	0.341	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
18	Q86U76	3.17e-108	321	410	0.561	0.371	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
19	Q8WV37	3.75e-108	325	535	0.568	0.288	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
20	Q8TAQ5	5.06e-108	329	688	0.590	0.233	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09538 FYDLN_acid	3.1e+02	13.4	Protein of unknown function (FYDLN_acid)
2	PF07754 HVO_2753_ZBP	1e+03	10.9	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF05691 Raffinose_syn	1.6e+02	11.4	Raffinose synthase or seed imbibition protein Sip1
4	PF05458 Siva	2.6	19.2	Cd27 binding protein (Siva)
5	PF01096 TFIIS_C	6e+02	11.7	Transcription factor S-II (TFIIS)
6	PF01286 XPA_N	7e-05	34.1	XPA protein N-terminal
7	PF01428 zf-AN1	49	15.5	AN1-like Zinc finger
8	PF00096 zf-C2H2	1.3e-50	178.2	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	5.5e-09	46.9	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	2.2e-24	95.0	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	2.1e-10	51.6	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	2.3e-05	35.8	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	5.6e-71	243.3	Zinc-finger double domain
14	PF13909 zf-H2C2_5	1.2	20.3	C2H2-type zinc-finger domain
15	PF12874 zf-met	1.9e+02	13.9	Zinc-finger of C2H2 type
16	PF13451 zf-trcl	13	17.1	Probable zinc-ribbon domain
17	PF18439 zf_UBZ	0.00047	31.1	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	0.022	26.8	zinc-ribbon family
19	PF14369 zinc_ribbon_9	7.2	18.3	zinc-ribbon
20	PF09723 Zn-ribbon_8	0.00048	31.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.874	Transcription intermediary factor 1-beta
2	9606.ENSP00000326813	0.729	Ubiquitin thioesterase OTU1
3	9606.ENSP00000305926	0.727	OTU domain-containing protein 7A
4	9606.ENSP00000258499	0.724	Ubiquitin carboxyl-terminal hydrolase 44
5	9606.ENSP00000229268	0.677	Ubiquitin carboxyl-terminal hydrolase 5
6	9606.ENSP00000441543	0.663	Polyubiquitin-C
7	9606.ENSP00000370208	0.564	RAB guanine nucleotide exchange factor 1
8	9606.ENSP00000271640	0.556	Histone-lysine N-methyltransferase SETDB1
9	9606.ENSP00000246548	0.544	SUMO-activating enzyme subunit 2
10	9606.ENSP00000264926	0.537	E3 ubiquitin-protein ligase RAD18
11	9606.ENSP00000366249	0.512	Ubiquitin D
12	9606.ENSP00000332194	0.504	Histone H2A type 2-C
13	9606.ENSP00000334061	0.500	Histone deacetylase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.940	heterocyclic compound binding
GO:0097159	0.940	organic cyclic compound binding
GO:0003676	0.931	nucleic acid binding
GO:0003677	0.882	DNA binding
GO:0043565	0.766	sequence-specific DNA binding
GO:0003690	0.705	double-stranded DNA binding
GO:1990837	0.702	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.961	cellular process
GO:0065007	0.902	biological regulation
GO:0050789	0.889	regulation of biological process
GO:0050794	0.855	regulation of cellular process
GO:0071840	0.845	cellular component organization or biogenesis
GO:0016043	0.838	cellular component organization
GO:0007030	0.826	Golgi organization
GO:0019222	0.808	regulation of metabolic process
GO:0060255	0.795	regulation of macromolecule metabolic process
GO:0051171	0.760	regulation of nitrogen compound metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0031323	0.606	regulation of cellular metabolic process
GO:0009889	0.471	regulation of biosynthetic process
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.458	regulation of macromolecule biosynthetic process
GO:0031326	0.458	regulation of cellular biosynthetic process
GO:0010468	0.457	regulation of gene expression
GO:2001141	0.448	regulation of RNA biosynthetic process
GO:0006355	0.417	regulation of DNA-templated transcription
GO:0050896	0.380	response to stimulus
GO:0048518	0.354	positive regulation of biological process
GO:0048519	0.336	negative regulation of biological process
GO:0048523	0.323	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.987	membrane-enclosed lumen
GO:0005654	0.984	nucleoplasm
GO:0005829	0.907	cytosol
GO:0043228	0.405	non-membrane-bounded organelle
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]