StarFunc result for job id Q96D05

User Input

>input (121 residues)
MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAA
QSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQ
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96D05	1.000	1.000	2.164E-21	121	1.000	1.000	Q96D05.pdb.gz	F241B_HUMAN Protein FAM241B OS=Homo sapiens OX=9606 GN=FAM241B PE=1 SV=1
2	AFDB:C0PEY7	0.197	0.089	1.533	321	0.157	0.059	C0PEY7.pdb.gz	PYG7_MAIZE Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic OS=Zea mays OX=4577 GN=PYG7 PE=2 SV=1
3	PDB:7e1vN	0.154	0.050	2.436	524	0.091	0.021	7e1vN.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
4	AFDB:P26715	0.165	0.093	2.498	233	0.182	0.094	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
5	AFDB:A8WG81	0.151	0.069	3.080	339	0.190	0.068	A8WG81.pdb.gz	A8WG81_DANRE Transmembrane protein 59-like OS=Danio rerio OX=7955 GN=wu:fi68e12 PE=2 SV=1
6	PDB:2rvqC	0.207	0.194	3.220	133	0.099	0.090	2rvqC.pdb.gz
7	AFDB:Q57Y13	0.170	0.089	3.541	329	0.124	0.046	Q57Y13.pdb.gz	Q57Y13_TRYB2 t-SNARE coiled-coil homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.450 PE=4 SV=1
8	AFDB:H0Y8E8	0.169	0.091	3.797	253	0.157	0.075	H0Y8E8.pdb.gz	H0Y8E8_HUMAN BRCA1 associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=BAP1 PE=1 SV=1
9	AFDB:H3BRB3	0.167	0.052	3.797	611	0.132	0.026	H3BRB3.pdb.gz	H3BRB3_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF22 PE=1 SV=2
10	AFDB:O88457	0.159	0.020	4.071	1765	0.140	0.010	O88457.pdb.gz	SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn11a PE=1 SV=1
11	PDB:6n7pA	0.174	0.116	4.565	186	0.149	0.097	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
12	AFDB:Q9H8K7	0.151	0.063	4.681	445	0.149	0.040	Q9H8K7.pdb.gz	PAAT_HUMAN ATPase PAAT OS=Homo sapiens OX=9606 GN=PAAT PE=1 SV=2
13	AFDB:Q9VYT3	0.157	0.026	4.681	1147	0.058	0.006	Q9VYT3.pdb.gz	Q9VYT3_DROME FI23714p1 OS=Drosophila melanogaster OX=7227 GN=Nrd1 PE=1 SV=2
14	PDB:7xayD	0.132	0.161	4.895	97	0.099	0.124	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
15	PDB:5apny	0.134	0.080	5.628	211	0.066	0.038	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7pj1A	0.174	0.171	6.471	123	0.091	0.089	7pj1A.pdb.gz
17	PDB:6zheC	0.118	0.034	6.938	705	0.107	0.018	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
18	PDB:7ujnA	0.128	0.044	6.938	487	0.025	0.006	7ujnA.pdb.gz	Phosphorylation of SAMHD1 Thr592 increases C-terminal domain dynamics, tetramer dissociation and ssDNA binding kinetics.
19	PDB:6f40P	0.172	0.098	7.977	246	0.066	0.033	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
20	PDB:7mqaSS	0.116	0.050	7.977	350	0.066	0.023	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96D05	1.27e-83	241	121	1.000	1.000	F241B_HUMAN Protein FAM241B OS=Homo sapiens OX=9606 GN=FAM241B PE=1 SV=1
2	Q9D882	5.82e-47	149	120	0.926	0.933	F241B_MOUSE Protein FAM241B OS=Mus musculus OX=10090 GN=Fam241b PE=1 SV=1
3	Q8N8J7	4.35e-07	47.4	132	0.182	0.167	F241A_HUMAN Uncharacterized protein FAM241A OS=Homo sapiens OX=9606 GN=FAM241A PE=2 SV=2
4	A1ZAN7	0.20	33.1	2205	0.132	0.007	A1ZAN7_DROME Rho guanine nucleotide exchange factor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
5	A0A0B4K7T7	0.24	32.7	2557	0.132	0.006	A0A0B4K7T7_DROME Rho guanine nucleotide exchange factor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
6	A0A0B4LFF8	0.24	32.7	2456	0.132	0.007	A0A0B4LFF8_DROME Rho guanine nucleotide exchange factor 2, isoform H OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
7	A1ZAN6	0.24	32.7	2559	0.132	0.006	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
8	O44113	0.24	32.7	2559	0.132	0.006	O44113_DROME Putative guanine nucleotide exchange factor RhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
9	Q8T9E3	0.24	32.7	2555	0.132	0.006	Q8T9E3_DROME SD04476p OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
10	O44381	0.26	32.7	2559	0.132	0.006	O44381_DROME Shar pei/DRhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
11	Q8VE91	0.27	32.3	480	0.132	0.033	RETR1_MOUSE Reticulophagy regulator 1 OS=Mus musculus OX=10090 GN=Retreg1 PE=1 SV=2
12	Q9M7B8	1.0	30.8	542	0.116	0.026	C79D1_MANES Valine N-monooxygenase 1 OS=Manihot esculenta OX=3983 GN=CYP79D1 PE=1 SV=1
13	W5PLZ6	1.1	30.8	1931	0.256	0.016	LPH_SHEEP Lactase/phlorizin hydrolase OS=Ovis aries OX=9940 GN=LCT PE=1 SV=1
14	P40559	2.0	30.0	946	0.091	0.012	INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP51 PE=1 SV=1
15	G1TPJ8	3.0	29.6	888	0.132	0.018	G1TPJ8_RABIT Glutamate receptor OS=Oryctolagus cuniculus OX=9986 GN=GRIN2D PE=3 SV=2
16	Q9CXJ4	3.4	29.3	717	0.207	0.035	MITOS_MOUSE Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1
17	X1WGZ3	3.6	29.3	620	0.132	0.026	X1WGZ3_DANRE Mitogen-activated protein kinase kinase kinase 3 OS=Danio rerio OX=7955 GN=map3k3 PE=4 SV=1
18	Q60749	3.7	29.3	443	0.132	0.036	KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus OX=10090 GN=Khdrbs1 PE=1 SV=2
19	Q91V33	3.7	29.3	443	0.132	0.036	KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1
20	Q9M7B7	4.3	28.9	541	0.116	0.026	C79D2_MANES Valine N-monooxygenase 2 OS=Manihot esculenta OX=3983 GN=CYP79D2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15378 DUF4605	2e-22	90.0	Domain of unknown function (DUF4605)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000013883

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023916	0.669	Zinc finger protein 710
2	61853.ENSNLEP00000007091	0.559	Hedgehog acyltransferase-like
3	61853.ENSNLEP00000016231	0.559	Immunoglobulin superfamily, member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.960	biological regulation
GO:0050789	0.842	regulation of biological process
GO:0050896	0.718	response to stimulus
GO:0050794	0.714	regulation of cellular process
GO:0008152	0.681	metabolic process
GO:0051179	0.676	localization
GO:0071704	0.545	organic substance metabolic process
GO:0044238	0.466	primary metabolic process
GO:0006807	0.425	nitrogen compound metabolic process
GO:0044237	0.419	cellular metabolic process
GO:0043170	0.351	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0016020	0.979	membrane
GO:0005783	0.820	endoplasmic reticulum
GO:0031090	0.706	organelle membrane
GO:0005829	0.602	cytosol
GO:0071944	0.578	cell periphery
GO:0005794	0.446	Golgi apparatus
GO:0005886	0.403	plasma membrane
GO:0005739	0.340	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]