StarFunc result for job id Q96D53

User Input

>input (544 residues)
MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIR
RAREARPRKTPRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRL
QSEGGSGLDSSPFLSEANAERIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVR
QSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
PGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQL
LANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFE
FRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS
RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCP
PPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSW
VDPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96D53	1.000	1.000	1.212E-86	544	1.000	1.000	Q96D53.pdb.gz	COQ8B_HUMAN Atypical kinase COQ8B, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
2	AFDB:M0R0L2	0.829	0.869	5.546E-72	518	0.950	0.998	M0R0L2.pdb.gz	M0R0L2_HUMAN Coenzyme Q8B OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
3	AFDB:Q566J8	0.853	0.870	1.330E-69	533	0.851	0.869	Q566J8.pdb.gz	COQ8B_MOUSE Atypical kinase COQ8B, mitochondrial OS=Mus musculus OX=10090 GN=Coq8b PE=1 SV=1
4	AFDB:A3QJU3	0.810	0.709	1.924E-54	624	0.585	0.510	A3QJU3.pdb.gz	COQ8B_DANRE Atypical kinase COQ8B, mitochondrial OS=Danio rerio OX=7955 GN=coq8b PE=3 SV=2
5	AFDB:Q8NI60	0.802	0.677	4.409E-53	647	0.557	0.468	Q8NI60.pdb.gz	COQ8A_HUMAN Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1
6	AFDB:Q60936	0.823	0.696	7.317E-53	645	0.544	0.459	Q60936.pdb.gz	COQ8A_MOUSE Atypical kinase COQ8A, mitochondrial OS=Mus musculus OX=10090 GN=Coq8a PE=1 SV=2
7	AFDB:Q18486	0.790	0.572	4.618E-44	755	0.425	0.306	Q18486.pdb.gz	COQ8_CAEEL Atypical kinase coq-8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-8 PE=3 SV=2
8	AFDB:Q9SBB2	0.775	0.679	6.676E-42	623	0.395	0.345	Q9SBB2.pdb.gz	ABC1_ARATH Protein ABC transporter 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABC1 PE=2 SV=1
9	AFDB:Q92338	0.755	0.676	2.315E-38	610	0.375	0.334	Q92338.pdb.gz	ABCI_SCHPO Protein ABC1 homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc1 PE=2 SV=1
10	AFDB:P27697	0.696	0.751	7.322E-38	501	0.358	0.389	P27697.pdb.gz	COQ8_YEAST Atypical kinase COQ8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ8 PE=1 SV=1
11	PDB:5yk1A	0.499	0.657	1.291E-17	401	0.169	0.229	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
12	PDB:6zxfz	0.265	0.373	4.480E-5	373	0.068	0.099	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	PDB:6g18v	0.236	0.370	1.075E-4	325	0.075	0.126	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
14	PDB:6zxdz	0.249	0.436	2.048E-4	292	0.068	0.127	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
15	PDB:7cgaA	0.211	0.304	2.462E-4	347	0.094	0.147	7cgaA.pdb.gz
16	PDB:4fi1A	0.214	0.300	2.700E-4	371	0.072	0.105	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP
17	PDB:1k9aB	0.228	0.271	3.902E-4	441	0.092	0.113	1k9aB.pdb.gz
18	PDB:6wqxC	0.221	0.469	5.387E-4	231	0.064	0.152	6wqxC.pdb.gz	Crystal structure of the human PRPK-TPRKB complex.
19	PDB:2qkwB	0.227	0.386	5.640E-4	292	0.081	0.151	2qkwB.pdb.gz
20	PDB:6b1uA	0.227	0.269	7.101E-4	442	0.116	0.143	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3QJU3	0.0	652	624	0.579	0.505	COQ8B_DANRE Atypical kinase COQ8B, mitochondrial OS=Danio rerio OX=7955 GN=coq8b PE=3 SV=2
2	M0R0L2	0.0	1050	518	0.952	1.000	M0R0L2_HUMAN Coenzyme Q8B OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
3	Q566J8	0.0	905	533	0.846	0.863	COQ8B_MOUSE Atypical kinase COQ8B, mitochondrial OS=Mus musculus OX=10090 GN=Coq8b PE=1 SV=1
4	Q60936	0.0	610	645	0.550	0.464	COQ8A_MOUSE Atypical kinase COQ8A, mitochondrial OS=Mus musculus OX=10090 GN=Coq8a PE=1 SV=2
5	Q8NI60	0.0	608	647	0.553	0.465	COQ8A_HUMAN Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1
6	Q96D53	0.0	1115	544	1.000	1.000	COQ8B_HUMAN Atypical kinase COQ8B, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
7	M0R011	1.81e-163	465	230	0.423	1.000	M0R011_HUMAN Atypical kinase COQ8B, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
8	Q18486	9.20e-153	457	755	0.412	0.297	COQ8_CAEEL Atypical kinase coq-8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-8 PE=3 SV=2
9	Q9SBB2	1.78e-141	424	623	0.382	0.334	ABC1_ARATH Protein ABC transporter 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABC1 PE=2 SV=1
10	P27697	3.90e-126	380	501	0.353	0.383	COQ8_YEAST Atypical kinase COQ8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ8 PE=1 SV=1
11	Q92338	7.39e-125	380	610	0.366	0.326	ABCI_SCHPO Protein ABC1 homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc1 PE=2 SV=1
12	M0R3F7	3.74e-106	316	157	0.289	1.000	M0R3F7_HUMAN Coenzyme Q8B (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
13	Q389Y6	7.73e-106	330	564	0.346	0.333	Q389Y6_TRYB2 ABC1 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0390 PE=3 SV=1
14	M0QZZ2	1.16e-100	302	149	0.274	1.000	M0QZZ2_HUMAN Atypical kinase COQ8B, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
15	M0R340	3.71e-79	246	121	0.222	1.000	M0R340_HUMAN Coenzyme Q8B (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
16	M0R307	3.00e-71	225	110	0.202	1.000	M0R307_HUMAN Coenzyme Q8B (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
17	O53343	3.11e-27	116	447	0.189	0.230	O53343_MYCTU Probable conserved ATP-binding protein ABC transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3197 PE=1 SV=1
18	Q9D0L4	2.41e-21	99.8	525	0.171	0.177	ADCK1_MOUSE AarF domain-containing protein kinase 1 OS=Mus musculus OX=10090 GN=Adck1 PE=1 SV=1
19	F4JRQ4	4.96e-21	98.6	481	0.129	0.146	F4JRQ4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g24810 PE=1 SV=1
20	Q86TW2	1.32e-19	94.4	530	0.176	0.181	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	9.3e-63	223.1	ABC1 atypical kinase-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333946	0.982	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
2	9606.ENSP00000262507	0.965	Ubiquinone biosynthesis protein COQ9, mitochondrial
3	9606.ENSP00000288532	0.953	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
4	9606.ENSP00000300452	0.940	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
5	9606.ENSP00000310873	0.940	4-hydroxybenzoate polyprenyltransferase, mitochondrial
6	9606.ENSP00000254759	0.938	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
7	9606.ENSP00000322316	0.934	5-demethoxyubiquinone hydroxylase, mitochondrial
8	9606.ENSP00000365388	0.934	Decaprenyl-diphosphate synthase subunit 1
9	9606.ENSP00000358033	0.886	Decaprenyl-diphosphate synthase subunit 2
10	9606.ENSP00000269321	0.775	Rho GDP-dissociation inhibitor 1
11	9606.ENSP00000312587	0.760	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
12	9606.ENSP00000263960	0.727	Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
13	9606.ENSP00000360431	0.684	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
14	9606.ENSP00000252891	0.660	Numb-like protein
15	9606.ENSP00000360195	0.658	KN motif and ankyrin repeat domain-containing protein 4
16	9606.ENSP00000356587	0.634	Podocin
17	9606.ENSP00000376410	0.617	Inverted formin-2
18	9606.ENSP00000072869	0.615	Uncharacterized aarF domain-containing protein kinase 2
19	9606.ENSP00000262030	0.604	ATP synthase subunit beta, mitochondrial
20	9606.ENSP00000368190	0.595	Nephrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016301	0.999	kinase activity
GO:0097159	0.951	organic cyclic compound binding
GO:1901363	0.946	heterocyclic compound binding
GO:0000166	0.928	nucleotide binding
GO:0097367	0.926	carbohydrate derivative binding
GO:0032553	0.897	ribonucleotide binding
GO:0032555	0.840	purine ribonucleotide binding
GO:0043168	0.830	anion binding
GO:0032559	0.829	adenyl ribonucleotide binding
GO:0043531	0.820	ADP binding
GO:0016773	0.783	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.770	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.968	cellular metabolic process
GO:0006744	0.932	ubiquinone biosynthetic process
GO:0032501	0.901	multicellular organismal process
GO:0048856	0.843	anatomical structure development
GO:0007275	0.798	multicellular organism development
GO:0030902	0.733	hindbrain development
GO:0021575	0.702	hindbrain morphogenesis
GO:0021680	0.702	cerebellar Purkinje cell layer development
GO:0021692	0.588	cerebellar Purkinje cell layer morphogenesis
GO:0065007	0.310	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.460	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.999	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.783	Phosphotransferases with an alcohol group as acceptor.

[back to server]