StarFunc result for job id Q96D71

User Input

>input (796 residues)
MEGLTLSDAEQKYYSDLFSYCDIESTKKVVVNGRVLELFRAAQLPNDVVLQIMELCGATR
LGYFGRSQFYIALKLVAVAQSGFPLRVESINTVKDLPLPRFVASKNEQESRHAASYSSDS
ENQGSYSGVIPPPPGRGQVKKGSVSHDTVQPRTSADAQEPASPVVSPQQSPPTSPHTWRK
HSRHPSGGNSERPLAGPGPFWSPFGEAQSGSSAGDAVWSGHSPPPPQENWVSFADTPPTS
TLLTMHPASVQDQTTVRTVASATTAIEIRRQSSSYDDPWKITDEQRQYYVNQFKTIQPDL
NGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLP
EKLPESLMPKLIDLEDSADVGDQPGEVGYSGSPAEAPPSKSPSMPSLNQTWPELNQSSEQ
WETFSERSSSSQTLTQFDSNIAPADPDTAIVHPVPIRMTPSKIHMQEMELKRTGSDHTNP
TSPLLVKPSDLLEENKINSSVKFASGNTVADGYSSSDSFTSDPEQIGSNVTRQRSHSGTS
PDNTAPPPPPPRPQPSHSRSSSLDMNRTFTVTTGQQQAGVVAHPPAVPPRPQPSQAPGPA
VHRPVDADGLITHTSTSPQQIPEQPNFADFSQFEVFAASNVNDEQDDEAEKHPEVLPAEK
ASDPASSLRVAKTDSKTEEKTAASAPANVSKGTTPLAPPPKPVRRRLKSEDELRPEVDEH
TQKTGVLAAVLASQPSIPRSVGKDKKAIQASIRRNKETNTVLARLNSELQQQLKDVLEER
ISLEVQLEQLRPFSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96D71	1.000	1.000	0.000	796	1.000	1.000	Q96D71.pdb.gz	REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3
2	AFDB:Q8MQS4	0.137	0.122	9.382E-24	907	0.244	0.214	Q8MQS4.pdb.gz	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
3	AFDB:M9NDL7	0.143	0.130	3.211E-23	878	0.239	0.216	M9NDL7.pdb.gz	M9NDL7_DROME RALBP1 associated Eps domain containing, isoform B OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
4	AFDB:F4HY32	0.113	0.075	1.876E-8	1247	0.212	0.136	F4HY32.pdb.gz	F4HY32_ARATH Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=ATEH2 PE=1 SV=1
5	PDB:4cidA	0.111	0.175	4.002E-5	497	0.044	0.070	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
6	AFDB:Q9JKC9	0.097	0.063	5.220E-4	1329	0.185	0.111	Q9JKC9.pdb.gz	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
7	PDB:7soxA	0.106	0.164	1.794E-3	514	0.048	0.074	7soxA.pdb.gz
8	AFDB:Q9Z2U4	0.078	0.089	2.234E-3	655	0.133	0.162	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
9	AFDB:Q8MMD2	0.114	0.075	4.371E-3	1232	0.178	0.115	Q8MMD2.pdb.gz	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
10	AFDB:P34758	0.121	0.112	5.467E-3	872	0.152	0.139	P34758.pdb.gz	SCD5_YEAST Protein SCD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCD5 PE=1 SV=1
11	AFDB:O14367	0.061	0.066	6.465E-3	720	0.132	0.146	O14367.pdb.gz	GTI1_SCHPO Gluconate transport inducer 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gti1 PE=4 SV=1
12	AFDB:A0A2K7P776	0.066	0.062	7.230E-3	867	0.156	0.143	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
13	PDB:7eebI	0.090	0.362	1.573E-1	174	0.020	0.092	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
14	PDB:1ggzA	0.076	0.343	2.327E-1	144	0.020	0.111	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
15	PDB:4e53A	0.085	0.327	3.639E-1	168	0.024	0.113	4e53A.pdb.gz
16	PDB:6gezB	0.077	0.112	4.304E-1	532	0.023	0.034	6gezB.pdb.gz	Dynamic tuning of FRET in a green fluorescent protein biosensor.
17	PDB:2ggmA	0.078	0.315	4.552E-1	149	0.021	0.114	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
18	PDB:2lcpA	0.085	0.301	4.813E-1	190	0.020	0.084	2lcpA.pdb.gz	The C-terminal tail of human neuronal calcium sensor 1 regulates the conformational stability of the ca(2+)-activated state.
19	PDB:1v1fA	0.081	0.313	5.383E-1	188	0.019	0.080	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
20	PDB:5x9aB	0.083	0.306	5.383E-1	198	0.010	0.040	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54916	0.0	1446	795	0.951	0.952	REPS1_MOUSE RalBP1-associated Eps domain-containing protein 1 OS=Mus musculus OX=10090 GN=Reps1 PE=1 SV=2
2	Q96D71	0.0	1620	796	1.000	1.000	REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3
3	Q8NFH8	9.90e-40	158	660	0.095	0.115	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
4	M9NDL7	5.36e-26	117	878	0.062	0.056	M9NDL7_DROME RALBP1 associated Eps domain containing, isoform B OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
5	Q8MQS4	6.46e-26	116	907	0.062	0.054	Q8MQS4_DROME GH06923p OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
6	Q54KI4	2.78e-16	86.3	1196	0.053	0.035	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
7	Q1WWC9	4.00e-16	85.5	1096	0.050	0.036	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
8	Q9VIF7	4.03e-16	85.5	1097	0.050	0.036	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	M9PBF6	4.12e-16	85.5	1088	0.050	0.037	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	O61618	4.13e-16	85.5	1094	0.050	0.037	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
11	M9ND00	5.64e-16	85.1	1190	0.050	0.034	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
12	M9PDC7	5.92e-16	85.1	1005	0.050	0.040	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	Q8INU2	6.05e-16	84.7	1014	0.050	0.039	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	O61639	6.20e-16	84.7	1011	0.050	0.040	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
15	Q10172	1.20e-14	80.9	1794	0.046	0.021	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
16	Q9HGL2	9.99e-14	77.8	1116	0.041	0.030	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
17	Q9WVE9	8.69e-13	75.1	1713	0.046	0.022	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
18	Q6GMY7	1.02e-12	73.9	648	0.045	0.056	Q6GMY7_HUMAN ITSN1 protein (Fragment) OS=Homo sapiens OX=9606 GN=ITSN1 PE=2 SV=1
19	F8W7U0	1.45e-12	73.9	1149	0.045	0.031	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
20	Q9N5B7	1.68e-12	73.6	786	0.043	0.043	Q9N5B7_CAEEL Dynamin-type G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rme-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	3.6	18.4	EF hand
2	PF12763 EF-hand_4	7.3e-13	59.7	Cytoskeletal-regulatory complex EF hand
3	PF13405 EF-hand_6	83	14.5	EF-hand domain
4	PF13499 EF-hand_7	49	15.8	EF-hand domain pair
5	PF13833 EF-hand_8	53	15.0	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000019317	0.979	RalA-binding protein 1
2	9606.ENSP00000386456	0.966	AP2-associated protein kinase 1
3	9606.ENSP00000360076	0.957	SH3-containing GRB2-like protein 3-interacting protein 1
4	9606.ENSP00000292807	0.936	AP-2 complex subunit mu
5	9606.ENSP00000298316	0.915	ADP-ribosylation factor 6
6	9606.ENSP00000314615	0.914	ADP-ribosylation factor GTPase-activating protein 1
7	9606.ENSP00000334836	0.910	BMP-2-inducible protein kinase
8	9606.ENSP00000345195	0.906	Ubiquilin-2
9	9606.ENSP00000347839	0.891	Rab11 family-interacting protein 2
10	9606.ENSP00000351926	0.884	AP-2 complex subunit alpha-1
11	9606.ENSP00000482835	0.882	AP-2 complex subunit beta
12	9606.ENSP00000349824	0.879	RalBP1-associated Eps domain-containing protein 2
13	9606.ENSP00000263270	0.873	AP-2 complex subunit sigma
14	9606.ENSP00000327694	0.867	AP-2 complex subunit alpha-2
15	9606.ENSP00000360798	0.867	Epidermal growth factor receptor substrate 15
16	9606.ENSP00000409667	0.845	Synaptojanin-1
17	9606.ENSP00000312250	0.833	ADP-dependent glucokinase
18	9606.ENSP00000450857	0.819	Stonin-2
19	9606.ENSP00000370719	0.815	Intersectin-1
20	9606.ENSP00000350199	0.799	AP-1 complex subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017124	0.883	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0051179	0.785	localization
GO:0051234	0.767	establishment of localization
GO:0006810	0.721	transport
GO:0048518	0.614	positive regulation of biological process
GO:0048522	0.597	positive regulation of cellular process
GO:0050896	0.541	response to stimulus
GO:0071840	0.525	cellular component organization or biogenesis
GO:0016192	0.495	vesicle-mediated transport
GO:0016043	0.477	cellular component organization
GO:0051641	0.467	cellular localization
GO:0051716	0.444	cellular response to stimulus
GO:0006897	0.345	endocytosis
GO:0007154	0.326	cell communication
GO:0051649	0.312	establishment of localization in cell
GO:0023052	0.311	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005829	1.000	cytosol
GO:0098590	0.997	plasma membrane region
GO:0005905	0.988	clathrin-coated pit
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0031982	0.816	vesicle
GO:0031410	0.730	cytoplasmic vesicle
GO:0032991	0.319	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]