StarFunc result for job id Q96DA2

User Input

>input (213 residues)
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKL
QIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVL
VGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEI
TIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BHC1	0.923	0.923	1.066E-44	213	0.995	0.995	Q8BHC1.pdb.gz	RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus OX=10090 GN=Rab39b PE=1 SV=1
2	AFDB:Q14964	0.939	0.922	1.102E-38	217	0.784	0.770	Q14964.pdb.gz	RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens OX=9606 GN=RAB39A PE=1 SV=2
3	PDB:6s5fA	0.871	0.986	6.463E-35	188	0.883	1.000	6s5fA.pdb.gz	Structure of the human RAB39B in complex with GMPPNP
4	AFDB:Q8SYS5	0.891	0.871	1.105E-30	218	0.535	0.523	Q8SYS5.pdb.gz	Q8SYS5_DROME RE37651p OS=Drosophila melanogaster OX=7227 GN=Rab39 PE=2 SV=1
5	AFDB:Q18969	0.882	0.821	5.634E-30	229	0.502	0.467	Q18969.pdb.gz	RAB39_CAEEL Ras-related protein rab-39 OS=Caenorhabditis elegans OX=6239 GN=rab-39 PE=1 SV=2
6	AFDB:Q8N4Z0	0.834	0.816	2.070E-26	218	0.427	0.417	Q8N4Z0.pdb.gz	RAB42_HUMAN Ras-related protein Rab-42 OS=Homo sapiens OX=9606 GN=RAB42 PE=1 SV=2
7	AFDB:Q38922	0.859	0.867	8.215E-26	211	0.404	0.408	Q38922.pdb.gz	RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana OX=3702 GN=RABB1B PE=2 SV=1
8	AFDB:P59279	0.862	0.850	1.124E-25	216	0.413	0.407	P59279.pdb.gz	RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus OX=10090 GN=Rab2b PE=1 SV=1
9	AFDB:Q93874	0.869	0.881	1.196E-25	210	0.385	0.390	Q93874.pdb.gz	Q93874_CAEEL Ras-related protein Rab-14 OS=Caenorhabditis elegans OX=6239 GN=rab-14 PE=1 SV=1
10	AFDB:P92963	0.856	0.864	1.444E-25	211	0.404	0.408	P92963.pdb.gz	RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana OX=3702 GN=RABB1C PE=1 SV=1
11	AFDB:O18333	0.862	0.862	1.743E-25	213	0.427	0.427	O18333.pdb.gz	RAB2_DROME Ras-related protein Rab-2 OS=Drosophila melanogaster OX=7227 GN=Rab2 PE=1 SV=1
12	PDB:5sziA	0.789	0.963	2.697E-23	174	0.394	0.483	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5szjA	0.752	0.911	4.250E-22	175	0.357	0.434	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:2ew1A	0.741	0.918	6.590E-22	171	0.371	0.462	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
15	PDB:1zbdA	0.772	0.926	1.912E-21	177	0.319	0.384	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
16	PDB:2f9mA	0.766	0.892	2.965E-21	182	0.376	0.440	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
17	PDB:5szhB	0.755	0.916	5.548E-21	175	0.347	0.423	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:8a4cB	0.764	0.953	5.548E-21	170	0.324	0.406	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
19	PDB:2zetA	0.756	0.885	2.658E-20	181	0.315	0.370	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
20	PDB:7e1tB	0.763	0.930	2.830E-20	174	0.305	0.374	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DA2	4.44e-159	439	213	1.000	1.000	RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens OX=9606 GN=RAB39B PE=1 SV=1
2	Q8BHC1	6.60e-159	439	213	0.995	0.995	RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus OX=10090 GN=Rab39b PE=1 SV=1
3	Q14964	1.69e-125	355	217	0.784	0.770	RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens OX=9606 GN=RAB39A PE=1 SV=2
4	Q8BHD0	2.03e-125	355	217	0.779	0.765	RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus OX=10090 GN=Rab39a PE=1 SV=1
5	Q8SYS5	9.29e-81	242	218	0.535	0.523	Q8SYS5_DROME RE37651p OS=Drosophila melanogaster OX=7227 GN=Rab39 PE=2 SV=1
6	Q9W3Q0	9.92e-81	241	218	0.535	0.523	Q9W3Q0_DROME FI07418p OS=Drosophila melanogaster OX=7227 GN=Rab39 PE=2 SV=1
7	Q18969	2.83e-74	226	229	0.516	0.480	RAB39_CAEEL Ras-related protein rab-39 OS=Caenorhabditis elegans OX=6239 GN=rab-39 PE=1 SV=2
8	O18333	1.02e-60	191	213	0.427	0.427	RAB2_DROME Ras-related protein Rab-2 OS=Drosophila melanogaster OX=7227 GN=Rab2 PE=1 SV=1
9	O01577	8.73e-60	188	214	0.427	0.425	O01577_CAEEL Ras-related protein Rab-2 OS=Caenorhabditis elegans OX=6239 GN=unc-108 PE=1 SV=1
10	I7FN62	1.06e-59	188	213	0.427	0.427	I7FN62_CAEEL Rab-2 (Fragment) OS=Caenorhabditis elegans OX=6239 GN=unc-108 PE=2 SV=1
11	P53994	1.63e-59	187	212	0.437	0.439	RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus OX=10090 GN=Rab2a PE=1 SV=1
12	P61019	3.38e-59	187	212	0.418	0.420	RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A PE=1 SV=1
13	Q8WUD1	3.43e-59	187	216	0.418	0.412	RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens OX=9606 GN=RAB2B PE=1 SV=1
14	P05712	4.68e-59	186	212	0.418	0.420	RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus OX=10116 GN=Rab2a PE=2 SV=1
15	P59279	1.37e-58	185	216	0.418	0.412	RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus OX=10090 GN=Rab2b PE=1 SV=1
16	A5PLC7	3.04e-57	182	209	0.399	0.407	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
17	P61028	3.79e-57	181	207	0.399	0.411	RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus OX=10090 GN=Rab8b PE=1 SV=1
18	P70550	3.79e-57	181	207	0.399	0.411	RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1
19	Q92930	4.57e-57	181	207	0.399	0.411	RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2
20	Q38922	1.73e-56	180	211	0.399	0.403	RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana OX=3702 GN=RABB1B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.7e+02	13.2	AAA domain
2	PF00025 Arf	1.8e-09	48.8	ADP-ribosylation factor family
3	PF11111 CENP-M	1.1e+02	13.4	Centromere protein M (CENP-M)
4	PF09544 DUF2381	3.5e+02	12.0	Protein of unknown function (DUF2381)
5	PF00009 GTP_EFTU	72	14.4	Elongation factor Tu GTP binding domain
6	PF04670 Gtr1_RagA	0.9	20.5	Gtr1/RagA G protein conserved region
7	PF01926 MMR_HSR1	0.0033	28.9	50S ribosome-binding GTPase
8	PF00071 Ras	7.9e-56	199.6	Ras family
9	PF08477 Roc	1.1e-27	108.0	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	2.1	19.7	RsgA GTPase
11	PF05621 TniB	3.7e+02	11.9	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008589295.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008577322.1	0.952	WD repeat-containing protein 41 isoform X1
2	482537.XP_008564434.1	0.951	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 7 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
3	482537.XP_008568135.1	0.930	Protein C9orf72 homolog isoform X1
4	482537.XP_008583196.1	0.917	Sequestosome-1
5	482537.XP_008585768.1	0.866	Ras-related protein Rab-8A
6	482537.XP_008566009.1	0.809	DENN domain-containing protein 5A isoform X1
7	482537.XP_008587159.1	0.760	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008587893.1	0.723	Ras-related protein Rab-8B
9	482537.XP_008562758.1	0.708	Ras-related protein Rab-20
10	482537.XP_008570530.1	0.692	Geranylgeranyl transferase type-2 subunit alpha isoform X1
11	482537.XP_008566315.1	0.690	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 23 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
12	482537.XP_008570409.1	0.685	Ras-related protein Rab-23
13	482537.XP_008567641.1	0.676	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 mRNAs, 24 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008563497.1	0.674	Ras-related protein Rab-7a
15	482537.XP_008572729.1	0.674	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
16	482537.XP_008580853.1	0.674	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 14 Proteins, and 88% coverage of the annotated genomic feature by RNAseq alignments
17	482537.XP_008570180.1	0.665	Ras-related protein Rab-9A
18	482537.XP_008576415.1	0.664	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008578673.1	0.660	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments
20	482537.XP_008581874.1	0.658	Ras-related protein Rab-9B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003924	0.501	GTPase activity
GO:1901363	0.428	heterocyclic compound binding
GO:0097159	0.428	organic cyclic compound binding
GO:0043167	0.390	ion binding
GO:0019001	0.371	guanyl nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0019222	0.898	regulation of metabolic process
GO:0051179	0.866	localization
GO:0071840	0.862	cellular component organization or biogenesis
GO:0016043	0.854	cellular component organization
GO:0009894	0.854	regulation of catabolic process
GO:0051234	0.837	establishment of localization
GO:0010506	0.834	regulation of autophagy
GO:0006810	0.820	transport
GO:0034330	0.624	cell junction organization
GO:0016192	0.575	vesicle-mediated transport
GO:0048518	0.351	positive regulation of biological process
GO:0051641	0.346	cellular localization
GO:0006996	0.341	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005794	0.991	Golgi apparatus
GO:0005829	0.950	cytosol
GO:0016020	0.893	membrane
GO:0031982	0.759	vesicle
GO:0097708	0.708	intracellular vesicle
GO:0031410	0.662	cytoplasmic vesicle
GO:0031090	0.482	organelle membrane
GO:0098588	0.366	bounding membrane of organelle
GO:0042995	0.338	cell projection
GO:0120025	0.327	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.501	GTP + H2O = GDP + H(+) + phosphate

[back to server]