StarFunc result for job id Q96DA6

User Input

>input (116 residues)
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTK
REAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DA6	1.000	1.000	5.145E-18	116	1.000	1.000	Q96DA6.pdb.gz	TIM14_HUMAN Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3
2	AFDB:Q6DDA1	0.679	0.538	2.360E-11	149	0.578	0.450	Q6DDA1.pdb.gz	DJC15_XENTR DnaJ homolog subfamily C member 15 OS=Xenopus tropicalis OX=8364 GN=dnajc15 PE=2 SV=1
3	AFDB:Q9Y5T4	0.613	0.482	1.817E-10	150	0.578	0.447	Q9Y5T4.pdb.gz	DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens OX=9606 GN=DNAJC15 PE=1 SV=2
4	AFDB:Q78YY6	0.596	0.470	2.475E-10	149	0.578	0.450	Q78YY6.pdb.gz	DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus OX=10090 GN=Dnajc15 PE=1 SV=1
5	AFDB:P91454	0.643	0.665	1.162E-9	112	0.457	0.473	P91454.pdb.gz	TIM14_CAEEL Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis elegans OX=6239 GN=dnj-21 PE=3 SV=1
6	AFDB:Q07914	0.591	0.414	6.473E-8	168	0.353	0.244	Q07914.pdb.gz	TIM14_YEAST Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM18 PE=1 SV=1
7	AFDB:Q9UT37	0.522	0.435	2.685E-7	140	0.405	0.336	Q9UT37.pdb.gz	TIM14_SCHPO Mitochondrial import inner membrane translocase subunit tim14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam18 PE=3 SV=1
8	AFDB:P42834	0.528	0.423	3.606E-6	146	0.371	0.295	P42834.pdb.gz	MDJ2_YEAST Mitochondrial DnaJ homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDJ2 PE=1 SV=1
9	AFDB:Q9C1W5	0.487	0.443	4.024E-5	128	0.233	0.211	Q9C1W5.pdb.gz	TIM16_SCHPO Mitochondrial import inner membrane translocase subunit tim16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam16 PE=3 SV=1
10	AFDB:Q94AW8	0.435	0.125	1.208E-3	420	0.155	0.043	Q94AW8.pdb.gz	DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana OX=3702 GN=ATJ3 PE=1 SV=2
11	PDB:6byrA	0.381	0.115	3.027E-1	405	0.155	0.044	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.315	0.162	4.386E-1	262	0.129	0.057	7x3kA.pdb.gz
13	PDB:3oqoA	0.172	0.073	9.214E-1	333	0.095	0.033	3oqoA.pdb.gz	Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.
14	PDB:5y88T	0.337	0.362	9.802E-1	107	0.086	0.093	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:1fpoA	0.360	0.252	1.935	171	0.103	0.070	1fpoA.pdb.gz
16	PDB:5jxdA	0.279	0.179	2.479	186	0.043	0.027	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
17	PDB:6ta5D	0.284	0.106	2.637	345	0.112	0.038	6ta5D.pdb.gz
18	PDB:3j79b	0.220	0.253	3.377	95	0.095	0.116	3j79b.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
19	PDB:4xgsB	0.206	0.157	3.377	164	0.121	0.085	4xgsB.pdb.gz	Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria
20	PDB:6eznE	0.220	0.278	3.592	85	0.069	0.094	6eznE.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DA6	5.28e-82	237	116	1.000	1.000	TIM14_HUMAN Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3
2	Q9CQV7	2.09e-80	233	116	0.983	0.983	TIM14_MOUSE Mitochondrial import inner membrane translocase subunit TIM14 OS=Mus musculus OX=10090 GN=Dnajc19 PE=1 SV=3
3	Q78YY6	9.43e-44	141	149	0.586	0.456	DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus OX=10090 GN=Dnajc15 PE=1 SV=1
4	Q9Y5T4	1.21e-43	141	150	0.578	0.447	DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens OX=9606 GN=DNAJC15 PE=1 SV=2
5	P91454	1.03e-34	117	112	0.500	0.518	TIM14_CAEEL Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis elegans OX=6239 GN=dnj-21 PE=3 SV=1
6	Q6DDA1	1.96e-32	112	149	0.440	0.342	DJC15_XENTR DnaJ homolog subfamily C member 15 OS=Xenopus tropicalis OX=8364 GN=dnajc15 PE=2 SV=1
7	Q9UT37	2.66e-21	84.3	140	0.405	0.336	TIM14_SCHPO Mitochondrial import inner membrane translocase subunit tim14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam18 PE=3 SV=1
8	Q07914	8.00e-21	84.0	168	0.319	0.220	TIM14_YEAST Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM18 PE=1 SV=1
9	P42834	3.83e-17	73.9	146	0.302	0.240	MDJ2_YEAST Mitochondrial DnaJ homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDJ2 PE=1 SV=1
10	Q38DE1	3.93e-04	40.4	451	0.172	0.044	Q38DE1_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3680 PE=3 SV=1
11	U5HUF9	5.05e-04	40.0	420	0.164	0.045	U5HUF9_NICBE MIP1.1a OS=Nicotiana benthamiana OX=4100 GN=MIP1 PE=2 SV=1
12	Q385J7	5.16e-04	40.0	423	0.172	0.047	Q385J7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3430 PE=4 SV=1
13	P08622	0.001	38.9	376	0.190	0.059	DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) OX=83333 GN=dnaJ PE=1 SV=3
14	Q6P3W2	0.001	38.1	149	0.129	0.101	DJC24_HUMAN DnaJ homolog subfamily C member 24 OS=Homo sapiens OX=9606 GN=DNAJC24 PE=1 SV=2
15	Q93VV9	0.002	37.4	116	0.267	0.267	TM16B_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 2 OS=Arabidopsis thaliana OX=3702 GN=PAM16L2 PE=2 SV=1
16	A0A1D8PSQ3	0.003	37.7	393	0.155	0.046	A0A1D8PSQ3_CANAL Type I HSP40 co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YDJ1 PE=3 SV=1
17	Q9C1W5	0.004	36.6	128	0.155	0.141	TIM16_SCHPO Mitochondrial import inner membrane translocase subunit tim16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam16 PE=3 SV=1
18	F4K0Y5	0.005	37.4	1165	0.164	0.016	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
19	O75953	0.013	36.2	348	0.181	0.060	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
20	O89114	0.013	36.2	348	0.181	0.060	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	0.0031	28.9	DnaJ domain
2	PF03656 Pam16	3.1	19.2	Pam16

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008586602.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008571340.1	0.989	grpE protein homolog 1, mitochondrial
2	482537.XP_008568211.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 12 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008572050.1	0.973	Coronin-7 isoform X1
4	482537.XP_008578242.1	0.972	Mitochondrial import inner membrane translocase subunit TIM44
5	482537.XP_008569657.1	0.971	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 7 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008571006.1	0.963	Stress-70 protein, mitochondrial
7	482537.XP_008580421.1	0.959	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 9 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008584640.1	0.957	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008590835.1	0.952	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008567819.1	0.939	Reactive oxygen species modulator 1
11	482537.XP_008579142.1	0.923	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008588472.1	0.875	Heat shock 70 kDa protein 4 isoform X1
13	482537.XP_008575338.1	0.804	SAFB-like transcription modulator isoform X1
14	482537.XP_008591274.1	0.797	Mitochondrial import inner membrane translocase subunit Tim22
15	482537.XP_008588769.1	0.770	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008571414.1	0.764	Mitochondrial-processing peptidase subunit alpha
17	482537.XP_008590511.1	0.731	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	482537.XP_008581286.1	0.730	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
19	482537.XP_008565640.1	0.718	Peptidyl-prolyl cis-trans isomerase FKBP2
20	482537.XP_008570456.1	0.708	methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.946	biological regulation
GO:0050789	0.929	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0032501	0.770	multicellular organismal process
GO:0032502	0.745	developmental process
GO:0009987	0.681	cellular process
GO:0019222	0.663	regulation of metabolic process
GO:0019216	0.642	regulation of lipid metabolic process
GO:0048856	0.599	anatomical structure development
GO:0007275	0.539	multicellular organism development
GO:0007600	0.504	sensory perception
GO:0050953	0.479	sensory perception of light stimulus
GO:0031323	0.474	regulation of cellular metabolic process
GO:0071840	0.446	cellular component organization or biogenesis
GO:0016043	0.443	cellular component organization
GO:0007548	0.442	sex differentiation
GO:0061458	0.410	reproductive system development
GO:0048513	0.391	animal organ development
GO:0048806	0.374	genitalia development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.996	mitochondrial membrane
GO:0032991	0.995	protein-containing complex
GO:0005743	0.993	mitochondrial inner membrane
GO:0070013	0.945	intracellular organelle lumen
GO:0098798	0.940	mitochondrial protein-containing complex
GO:0098796	0.927	membrane protein complex
GO:0098800	0.835	inner mitochondrial membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]