StarFunc result for job id Q96DC8

User Input

>input (303 residues)
MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIV
LSNPKKRNALSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY
HAEVFQTCSKVMMHIRNHPVPVIAMVNGLAAAAGCQLVASCDIAVASDKSSFATPGVNVG
LFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKI
ASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
EPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DC8	1.000	1.000	1.265E-58	303	1.000	1.000	Q96DC8.pdb.gz	ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=ECHDC3 PE=1 SV=2
2	AFDB:Q3MIE0	0.861	0.870	1.482E-49	300	0.809	0.817	Q3MIE0.pdb.gz	ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echdc3 PE=2 SV=1
3	AFDB:P14604	0.781	0.815	1.121E-23	290	0.274	0.286	P14604.pdb.gz	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
4	AFDB:P30084	0.781	0.814	1.496E-23	290	0.317	0.331	P30084.pdb.gz	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
5	AFDB:P34559	0.762	0.800	1.778E-23	288	0.264	0.278	P34559.pdb.gz	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
6	AFDB:F4JML5	0.816	0.821	8.442E-23	301	0.261	0.262	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
7	PDB:2hw5C	0.772	0.894	8.673E-23	260	0.274	0.319	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
8	PDB:5zaiC	0.808	0.941	1.733E-22	259	0.248	0.290	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
9	AFDB:A4YI89	0.809	0.943	2.384E-22	259	0.248	0.290	A4YI89.pdb.gz	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
10	AFDB:Q7JR58	0.780	0.800	2.526E-22	295	0.267	0.275	Q7JR58.pdb.gz	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
11	AFDB:P9WNN7	0.778	0.825	4.007E-22	285	0.251	0.267	P9WNN7.pdb.gz	ECH12_MYCTU Probable enoyl-CoA hydratase EchA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA12 PE=1 SV=1
12	PDB:3h81A	0.782	0.920	4.620E-22	256	0.234	0.277	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
13	AFDB:C8V3K8	0.785	0.821	6.357E-22	289	0.264	0.277	C8V3K8.pdb.gz	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
14	PDB:1dubA	0.768	0.888	1.465E-21	260	0.261	0.304	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
15	PDB:4fzwB	0.776	0.911	7.802E-21	256	0.244	0.289	4fzwB.pdb.gz
16	PDB:1jxzB	0.769	0.862	1.046E-19	269	0.195	0.219	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis
17	PDB:7oeqA	0.724	0.839	1.659E-19	259	0.231	0.270	7oeqA.pdb.gz
18	PDB:4i42A	0.634	0.671	7.877E-19	285	0.264	0.281	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily
19	PDB:6wyiA	0.718	0.908	1.667E-18	237	0.185	0.236	6wyiA.pdb.gz
20	PDB:4fzwD	0.741	0.889	2.225E-18	250	0.205	0.248	4fzwD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DC8	0.0	622	303	1.000	1.000	ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=ECHDC3 PE=1 SV=2
2	Q9D7J9	0.0	503	300	0.815	0.823	ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Echdc3 PE=1 SV=1
3	Q3MIE0	1.47e-178	496	300	0.809	0.817	ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echdc3 PE=2 SV=1
4	P30084	4.44e-35	130	290	0.274	0.286	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
5	A4YI89	1.31e-34	128	259	0.257	0.301	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	Q8BH95	2.04e-34	128	290	0.271	0.283	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
7	P14604	4.86e-33	125	290	0.261	0.272	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
8	P34559	1.53e-32	123	288	0.254	0.267	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
9	Q7JR58	6.47e-30	116	295	0.248	0.254	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
10	P9WNN9	8.54e-30	115	257	0.241	0.284	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
11	P76082	2.18e-29	114	255	0.251	0.298	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
12	C8V3K8	5.40e-29	114	289	0.281	0.294	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
13	Q9I298	3.00e-26	106	265	0.228	0.260	Q9I298_PSEAE 3-methylglutaconyl-CoA hydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuC PE=3 SV=1
14	P0ABU0	3.33e-24	101	285	0.261	0.277	MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) OX=83333 GN=menB PE=1 SV=1
15	P9WNN7	4.44e-24	100	285	0.261	0.277	ECH12_MYCTU Probable enoyl-CoA hydratase EchA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA12 PE=1 SV=1
16	A1Z934	4.86e-24	101	299	0.274	0.278	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
17	F4JML5	8.72e-24	100	301	0.224	0.226	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
18	G4V4T7	1.06e-23	99.4	265	0.254	0.291	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
19	Q78JN3	4.00e-23	99.0	317	0.234	0.224	ECI3_MOUSE Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus OX=10090 GN=Eci3 PE=1 SV=1
20	P52045	4.60e-23	97.8	261	0.254	0.295	SCPB_ECOLI Methylmalonyl-CoA decarboxylase OS=Escherichia coli (strain K12) OX=83333 GN=scpB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	2.1e-50	183.0	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	3.3e-26	104.2	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360035	0.657	Protein phosphatase 1 regulatory subunit 3D
2	9606.ENSP00000380008	0.634	Leukotriene B4 receptor 1
3	9606.ENSP00000461269	0.602	SLP adapter and CSK-interacting membrane protein
4	9606.ENSP00000436047	0.599	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
5	9606.ENSP00000238994	0.587	Protein phosphatase 1 regulatory subunit 3C
6	9606.ENSP00000277575	0.576	USP6 N-terminal-like protein
7	9606.ENSP00000039989	0.535	Tetratricopeptide repeat protein 17
8	9606.ENSP00000424198	0.531	Kelch-like protein 2
9	9606.ENSP00000330959	0.526	Interleukin-1 receptor type 2
10	9606.ENSP00000199447	0.522	Thioredoxin domain-containing protein 3
11	9606.ENSP00000359423	0.510	Myotubularin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016836	0.998	hydro-lyase activity
GO:0004300	0.994	enoyl-CoA hydratase activity
GO:0005488	0.991	binding
GO:0005515	0.893	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0008152	0.979	metabolic process
GO:0044238	0.963	primary metabolic process
GO:0071704	0.937	organic substance metabolic process
GO:0065007	0.910	biological regulation
GO:0044237	0.881	cellular metabolic process
GO:0050789	0.877	regulation of biological process
GO:0050794	0.871	regulation of cellular process
GO:0048583	0.604	regulation of response to stimulus
GO:0048518	0.489	positive regulation of biological process
GO:1900076	0.445	regulation of cellular response to insulin stimulus
GO:0044281	0.400	small molecule metabolic process
GO:0006629	0.344	lipid metabolic process
GO:0048522	0.337	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.978	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.2.1.-	0.998	Hydro-lyases.
RHEA:16105	0.994	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	0.994	enoyl-CoA hydratase.

[back to server]