StarFunc result for job id Q96DE0

User Input

>input (195 residues)
MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGG
FVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEEL
LAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL
LQSGSISGLKIPAHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DE0	1.000	1.000	7.805E-44	195	1.000	1.000	Q96DE0.pdb.gz	NUD16_HUMAN U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606 GN=NUDT16 PE=1 SV=2
2	PDB:3couA	0.910	0.985	4.159E-37	180	0.918	0.994	3couA.pdb.gz
3	AFDB:Q6P3D0	0.980	0.980	7.575E-37	195	0.795	0.795	Q6P3D0.pdb.gz	NUD16_MOUSE U8 snoRNA-decapping enzyme OS=Mus musculus OX=10090 GN=Nudt16 PE=1 SV=1
4	AFDB:Q6TEC1	0.924	0.852	1.781E-30	212	0.569	0.524	Q6TEC1.pdb.gz	NUD16_XENLA U8 snoRNA-decapping enzyme OS=Xenopus laevis OX=8355 GN=nudt16 PE=1 SV=1
5	PDB:1u20A	0.920	0.916	8.800E-29	196	0.564	0.561	1u20A.pdb.gz
6	AFDB:Q9BRJ7	0.872	0.809	1.152E-27	211	0.538	0.498	Q9BRJ7.pdb.gz	TIRR_HUMAN Tudor-interacting repair regulator protein OS=Homo sapiens OX=9606 GN=NUDT16L1 PE=1 SV=1
7	AFDB:B4DLR9	0.750	0.986	1.474E-27	148	0.651	0.858	B4DLR9.pdb.gz	B4DLR9_HUMAN cDNA FLJ53804, highly similar to Nucleoside diphosphate-linked moiety X motif 16 OS=Homo sapiens OX=9606 PE=1 SV=1
8	PDB:5zcjB	0.872	0.844	1.919E-27	202	0.544	0.525	5zcjB.pdb.gz
9	PDB:1nqzA	0.473	0.533	2.440E-7	171	0.154	0.175	1nqzA.pdb.gz
10	PDB:3ffuA	0.488	0.676	1.754E-6	133	0.190	0.278	3ffuA.pdb.gz	Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
11	AFDB:Q8PTX6	0.470	0.530	4.348E-6	170	0.185	0.212	Q8PTX6.pdb.gz	PRDPP_METMA Prenyl-diphosphate phosphatase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_2582 PE=1 SV=1
12	AFDB:Q92350	0.448	0.315	4.624E-6	285	0.138	0.095	Q92350.pdb.gz	YDH5_SCHPO Probable nudix hydrolase C6G9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G9.05 PE=3 SV=1
13	AFDB:O69640	0.486	0.364	5.231E-6	273	0.179	0.128	O69640.pdb.gz	O69640_MYCTO Nudix hydrolase domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3773 PE=3 SV=1
14	AFDB:P43337	0.409	0.414	5.231E-6	192	0.154	0.156	P43337.pdb.gz	NUDL_ECOLI Uncharacterized Nudix hydrolase NudL OS=Escherichia coli (strain K12) OX=83333 GN=nudL PE=3 SV=1
15	AFDB:Q9RV46	0.535	0.537	5.564E-6	194	0.185	0.186	Q9RV46.pdb.gz	Y1184_DEIRA Nudix hydrolase DR_1184 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_1184 PE=1 SV=1
16	PDB:5t3pC	0.457	0.408	2.064E-5	221	0.179	0.158	5t3pC.pdb.gz
17	PDB:2rrkA	0.450	0.589	2.335E-5	140	0.221	0.307	2rrkA.pdb.gz
18	PDB:2gt4A	0.350	0.415	4.601E-5	160	0.123	0.150	2gt4A.pdb.gz	X-ray, NMR, and mutational studies of the catalytic cycle of the GDP-mannose mannosyl hydrolase reaction.
19	PDB:1xscA	0.478	0.589	5.204E-5	153	0.138	0.176	1xscA.pdb.gz	Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase
20	PDB:3mdgB	0.432	0.406	6.659E-5	210	0.128	0.119	3mdgB.pdb.gz	Structural basis of UGUA recognition by the Nudix protein CFI(m)25 and implications for a regulatory role in mRNA 3' processing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DE0	1.72e-138	386	195	1.000	1.000	NUD16_HUMAN U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606 GN=NUDT16 PE=1 SV=2
2	Q6P3D0	6.25e-110	314	195	0.795	0.795	NUD16_MOUSE U8 snoRNA-decapping enzyme OS=Mus musculus OX=10090 GN=Nudt16 PE=1 SV=1
3	B4DLR9	3.41e-85	249	148	0.651	0.858	B4DLR9_HUMAN cDNA FLJ53804, highly similar to Nucleoside diphosphate-linked moiety X motif 16 OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q6TEC1	6.67e-67	206	212	0.574	0.528	NUD16_XENLA U8 snoRNA-decapping enzyme OS=Xenopus laevis OX=8355 GN=nudt16 PE=1 SV=1
5	Q9BRJ7	6.82e-67	206	211	0.538	0.498	TIRR_HUMAN Tudor-interacting repair regulator protein OS=Homo sapiens OX=9606 GN=NUDT16L1 PE=1 SV=1
6	Q55928	0.060	35.8	339	0.144	0.083	NADM_SYNY3 Bifunctional NMN adenylyltransferase/Nudix hydrolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0787 PE=1 SV=1
7	P75080	1.7	32.0	1443	0.113	0.015	DPO3_MYCPN DNA polymerase III PolC-type OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=polC PE=1 SV=1
8	Q8EFJ3	3.6	30.4	237	0.082	0.068	Q8EFJ3_SHEON Transcriptional repressor of nicotinamide riboside utilization NrtR OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nrtR PE=1 SV=1
9	Q9P791	4.6	30.0	205	0.092	0.088	YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.12 PE=3 SV=1
10	Q9CR24	4.9	30.0	210	0.072	0.067	NUDT8_MOUSE Mitochondrial coenzyme A diphosphatase NUDT8 OS=Mus musculus OX=10090 GN=Nudt8 PE=1 SV=1
11	P52006	6.0	29.3	141	0.082	0.113	NUDI_ECOLI Nucleoside triphosphatase NudI OS=Escherichia coli (strain K12) OX=83333 GN=nudI PE=1 SV=2
12	U4PRA5	8.4	29.6	1089	0.067	0.012	U4PRA5_CAEEL ATP-dependent RNA helicase DHX34 OS=Caenorhabditis elegans OX=6239 GN=smgl-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	0.0036	28.8	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000003867

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000008544	0.929	Inosine triphosphate pyrophosphatase
2	9593.ENSGGOP00000002557	0.921	Tumor protein p53 binding protein 1
3	9593.ENSGGOP00000010831	0.905	Adenylosuccinate synthetase
4	9593.ENSGGOP00000002293	0.902	Nucleoside diphosphate kinase
5	9593.ENSGGOP00000004423	0.902	NME/NM23 nucleoside diphosphate kinase 4
6	9593.ENSGGOP00000005938	0.902	NME/NM23 nucleoside diphosphate kinase 6
7	9593.ENSGGOP00000006094	0.902	NME/NM23 nucleoside diphosphate kinase 3
8	9593.ENSGGOP00000008084	0.902	5'-nucleotidase, cytosolic IA
9	9593.ENSGGOP00000012922	0.902	Inosine-5'-monophosphate dehydrogenase
10	9593.ENSGGOP00000014620	0.902	Uncharacterized protein
11	9593.ENSGGOP00000016124	0.902	NME/NM23 nucleoside diphosphate kinase 1
12	9593.ENSGGOP00000009886	0.901	5'-nucleotidase, cytosolic IIIB
13	9593.ENSGGOP00000012654	0.901	Adenylosuccinate synthetase
14	9593.ENSGGOP00000000884	0.900	5'-nucleotidase, ecto (CD73)
15	9593.ENSGGOP00000004085	0.900	GMP reductase
16	9593.ENSGGOP00000004641	0.900	5', 3'-nucleotidase, cytosolic
17	9593.ENSGGOP00000004924	0.900	Ectonucleoside triphosphate diphosphohydrolase 3
18	9593.ENSGGOP00000005236	0.900	Ectonucleoside triphosphate diphosphohydrolase 1
19	9593.ENSGGOP00000013001	0.900	AMP deaminase
20	9593.ENSGGOP00000013470	0.900	AMP deaminase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030515	0.999	snoRNA binding
GO:0017110	0.999	nucleoside diphosphate phosphatase activity
GO:0046914	0.998	transition metal ion binding
GO:0000287	0.994	magnesium ion binding
GO:0030145	0.985	manganese ion binding
GO:0050897	0.973	cobalt ion binding
GO:0042802	0.908	identical protein binding
GO:0046983	0.837	protein dimerization activity
GO:0042803	0.819	protein homodimerization activity
GO:0016788	0.654	hydrolase activity, acting on ester bonds
GO:0031404	0.619	chloride ion binding
GO:0050072	0.582	m7G(5')pppN diphosphatase activity
GO:0004519	0.574	endonuclease activity
GO:0140640	0.504	catalytic activity, acting on a nucleic acid
GO:0008237	0.481	metallopeptidase activity
GO:0004521	0.450	RNA endonuclease activity
GO:0016893	0.448	endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
GO:0008235	0.441	metalloexopeptidase activity
GO:0016891	0.440	RNA endonuclease activity, producing 5'-phosphomonoesters

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0006401	0.979	RNA catabolic process
GO:0010629	0.929	negative regulation of gene expression
GO:0050794	0.790	regulation of cellular process
GO:0006402	0.782	mRNA catabolic process
GO:0090305	0.521	nucleic acid phosphodiester bond hydrolysis
GO:0006753	0.491	nucleoside phosphate metabolic process
GO:0009117	0.411	nucleotide metabolic process
GO:0006163	0.379	purine nucleotide metabolic process
GO:1901292	0.359	nucleoside phosphate catabolic process
GO:1901135	0.355	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.985	cytoplasm
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0070013	0.956	intracellular organelle lumen
GO:0005654	0.934	nucleoplasm
GO:0005730	0.866	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36799	0.999	a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H(+) + phosphate
EC:3.6.1.6	0.999	nucleoside diphosphate phosphatase.
EC:3.1.-.-	0.654	Acting on ester bonds.
EC:3.6.1.30	0.582	Transferred entry: 3.6.1.59 and 3.6.1.62.
EC:3.4.-.-	0.481	Acting on peptide bonds (peptidases).
EC:3.1.30.-	0.448	Endoribonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.
EC:3.1.26.-	0.440	Endoribonucleases producing 5'-phosphomonoesters.

[back to server]