StarFunc result for job id Q96DE9

User Input

>input (158 residues)
MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVER
LGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKY
LTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TE69	1.000	1.000	1.846E-36	158	0.987	0.987	Q8TE69.pdb.gz	EOLA1_HUMAN Protein EOLA1 OS=Homo sapiens OX=9606 GN=EOLA1 PE=1 SV=3
2	PDB:5y7dA	0.988	0.969	2.611E-35	161	0.975	0.957	5y7dA.pdb.gz
3	AFDB:A0A0R4IR18	0.567	0.177	1.024E-8	564	0.203	0.057	A0A0R4IR18.pdb.gz	A0A0R4IR18_DANRE Activating signal cointegrator 1 OS=Danio rerio OX=7955 GN=dZ221I3.1 PE=1 SV=1
4	AFDB:Q15650	0.554	0.169	2.496E-8	581	0.165	0.045	Q15650.pdb.gz	TRIP4_HUMAN Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4
5	AFDB:Q9QXN3	0.548	0.167	8.361E-8	581	0.165	0.045	Q9QXN3.pdb.gz	TRIP4_MOUSE Activating signal cointegrator 1 OS=Mus musculus OX=10090 GN=Trip4 PE=1 SV=2
6	AFDB:G5EDK1	0.594	0.253	1.465E-6	425	0.158	0.059	G5EDK1.pdb.gz	G5EDK1_CAEEL ASC-1 OS=Caenorhabditis elegans OX=6239 GN=trip-4 PE=1 SV=1
7	AFDB:Q9SK61	0.587	0.299	3.804E-6	339	0.190	0.088	Q9SK61.pdb.gz	Q9SK61_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g20410 PE=1 SV=2
8	AFDB:P67603	0.359	0.508	1.070E-1	103	0.127	0.194	P67603.pdb.gz	AC4CH_ECOLI N(4)-acetylcytidine amidohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=yqfB PE=1 SV=1
9	PDB:6h0gB	0.324	0.154	1.975E-1	401	0.120	0.047	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
10	AFDB:Q09769	0.319	0.063	4.337E-1	1067	0.127	0.019	Q09769.pdb.gz	LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=3 SV=1
11	AFDB:Q8WTY4	0.154	0.100	4.926E-1	309	0.070	0.036	Q8WTY4.pdb.gz	CPIN1_MOUSE Anamorsin OS=Mus musculus OX=10090 GN=Ciapin1 PE=1 SV=1
12	AFDB:H3BV90	0.156	0.116	5.962E-1	246	0.063	0.041	H3BV90.pdb.gz	H3BV90_HUMAN Cytokine induced apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=1
13	PDB:1j70A	0.195	0.076	8.534E-1	512	0.063	0.020	1j70A.pdb.gz	Structural and functional analysis of a truncated form of Saccharomyces cerevisiae ATP sulfurylase: C-terminal domain essential for oligomer formation but not for activity.
14	PDB:7zelA	0.153	0.055	1.173	827	0.089	0.017	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
15	PDB:6jv9B	0.140	0.060	1.250	495	0.127	0.040	6jv9B.pdb.gz
16	PDB:3orhA	0.132	0.107	1.420	230	0.089	0.061	3orhA.pdb.gz	The crystal structure of human guanidinoacetate N-methyltransferase with SAH
17	PDB:1rf4A	0.148	0.068	1.613	427	0.101	0.037	1rf4A.pdb.gz	Structural studies of Streptococcus pneumoniae EPSP synthase in unliganded state, tetrahedral intermediate-bound state and S3P-GLP-bound state.
18	PDB:6pz0A	0.130	0.115	1.831	185	0.095	0.081	6pz0A.pdb.gz	The minimal structure for iodotyrosine deiodinase function is defined by an outlier protein from the thermophilic bacterium Thermotoga neapolitana.
19	PDB:7eg0B	0.156	0.059	1.831	567	0.101	0.028	7eg0B.pdb.gz	Structure of PDE3A-SLFN12 complex and structure-based design for a potent apoptosis inducer of tumor cells.
20	PDB:7kiuA	0.120	0.085	1.831	263	0.095	0.057	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TE69	1.99e-113	320	158	0.987	0.987	EOLA1_HUMAN Protein EOLA1 OS=Homo sapiens OX=9606 GN=EOLA1 PE=1 SV=3
2	P16086	0.10	35.0	2472	0.234	0.015	SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2
3	P16546	0.10	35.0	2472	0.234	0.015	SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4
4	A0A0D9SGF6	0.26	33.5	2498	0.228	0.014	A0A0D9SGF6_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
5	A0A0D9SF54	0.27	33.5	2457	0.228	0.015	A0A0D9SF54_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
6	A0A384P5S9	0.27	33.5	2452	0.228	0.015	A0A384P5S9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q13813	0.29	33.5	2472	0.228	0.015	SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3
8	A0A0R4IR18	0.38	33.1	564	0.203	0.057	A0A0R4IR18_DANRE Activating signal cointegrator 1 OS=Danio rerio OX=7955 GN=dZ221I3.1 PE=1 SV=1
9	A3FG33	0.62	32.7	2480	0.215	0.014	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
10	P07751	0.71	32.3	2477	0.196	0.013	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
11	B6A880	0.96	32.0	1487	0.133	0.014	YENB_YERET Toxin subunit YenB OS=Yersinia entomophaga OX=935293 GN=yenB PE=1 SV=1
12	Q6P4P8	1.0	32.0	852	0.076	0.014	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
13	Q8DS93	1.8	30.8	250	0.082	0.052	Q8DS93_STRMU Response regulator of the competence regulon, ComE response regulator of sakacin A production OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=comE PE=4 SV=1
14	Q9M1S8	2.3	30.8	705	0.114	0.026	GCP2_ARATH Probable glutamate carboxypeptidase AMP1 OS=Arabidopsis thaliana OX=3702 GN=AMP1 PE=1 SV=3
15	Q9LE20	2.4	30.8	510	0.120	0.037	DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana OX=3702 GN=DTX54 PE=2 SV=1
16	E7F4J7	2.9	30.4	4119	0.133	0.005	E7F4J7_DANRE DNA-dependent protein kinase catalytic subunit OS=Danio rerio OX=7955 GN=prkdc PE=1 SV=1
17	X2JA38	3.6	30.4	5150	0.158	0.005	X2JA38_DROME Tweek, isoform J OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
18	M9MRK7	3.7	30.4	5116	0.158	0.005	M9MRK7_DROME Tweek, isoform H OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
19	M9MSI8	3.7	30.4	5075	0.158	0.005	M9MSI8_DROME Tweek, isoform I OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
20	X2JAP2	3.7	30.4	5110	0.158	0.005	X2JAP2_DROME Tweek, isoform K OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04266 ASCH	2.6	20.1	ASCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375593	0.650	Zinc finger and SCAN domain-containing protein 5A
2	9606.ENSP00000472867	0.599	Zinc finger protein interacting with ribonucleoprotein K
3	9606.ENSP00000284617	0.558	Centriole, cilia and spindle-associated protein
4	9606.ENSP00000284881	0.558	Protein EURL homolog
5	9606.ENSP00000314608	0.556	Kelch-like protein 11
6	9606.ENSP00000359411	0.544	KH homology domain-containing protein 1
7	9606.ENSP00000248901	0.535	Cytohesin-4
8	9606.ENSP00000272395	0.517	Tripartite motif containing 43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0010468	0.962	regulation of gene expression
GO:0032675	0.900	regulation of interleukin-6 production
GO:0009987	0.696	cellular process
GO:0008152	0.538	metabolic process
GO:0071704	0.455	organic substance metabolic process
GO:0044238	0.377	primary metabolic process
GO:0044237	0.334	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.878	intracellular anatomical structure
GO:0005737	0.817	cytoplasm
GO:0043229	0.364	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]