StarFunc result for job id Q96DN5

User Input

>input (1066 residues)
MQSTDLGNKESGKIWHRKPSPATRDGIIVNIIHNTSDYHPKVLRFLNVAFDGTGDCLIAG
DHQGNIYVFDLHGNRFNLVQRTAQACTALAFNLRRKSEFLVALADYSIKCFDTVTKELVS
WMRGHESSVFSISVHASGKYAITTSSDTAQLWDLDTFQRKRKLNIRQSVGIQKVFFLPLS
NTILSCFKDNSIFAWECDTLFCKYQLPAPPESSSILYKVFAVTRDGRILAAGGKSNHLHL
WCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQVLGVLSQDGIMRFINMQTCKLLF
EIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQALTQEINKPPPPLVKVIEDLPKNK
LSSSDLKMKVTSGRVQQPAKSRESKMQTRILKQDLTGDFESKKNELPDGLNKKRLQILLK
GYGEYPTKYRMFIWRSLLQLPENHTAFSTLIDKGTHVAFLNLQKKYPIKSRKLLRVLQRT
LSALAHWSVIFSDTPYLPLLAFPFVKLFQNNQLICFEVIATLIINWCQHWFEYFPNPPIN
ILSMIENVLAFHDKELLQHFIDHDITSQLYAWPLLETVFSEVLTREEWLKLFDNIFSNHP
SFLLMTVVAYNICSRTPLLSCNLKDDFEFFFHHRNNLDINVVIRQVYHLMETTPTDIHPD
SMLNVFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDELDYLRERQTVEDMQAKVDQQR
VEDEAWYQKQELLRKAEETRREMLLQEEEKMIQQRQRLAAVKRELKVKEMHLQDAARRRF
LKLQQDQQEMELRRLDDEIGRKVYMRDREIAATARDLEMRQLELESQKRLYEKNLTENQE
ALAKEMRADADAYRRKVDLEEHMFHKLIEAGETQSQKTQKVIKENLAKAEQACLNTDWQI
QSLHKQKCDDLQRNKCYQEVAKLLRENRRKEIEIINAMVEEEAKKWKEAEGKEFRLRSAK
KASALSDASRKWFLKQEINAAVEHAENPCHKEEPRFQNEQDSSCLPRTSQLNDSSEMDPS
TQISLNRRAVEWDTTGQNLIKKVRNLRQRLTARARHRCQTPHLLAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H2LP95	0.464	0.464	0.000	1067	0.559	0.559	H2LP95.pdb.gz	TBC31_ORYLA TBC1 domain family member 31 OS=Oryzias latipes OX=8090 GN=tbc1d31 PE=3 SV=2
2	AFDB:Q96DN5	1.000	1.000	0.000	1066	1.000	1.000	Q96DN5.pdb.gz	TBC31_HUMAN TBC1 domain family member 31 OS=Homo sapiens OX=9606 GN=TBC1D31 PE=1 SV=2
3	PDB:5mzhB	0.235	0.560	1.226E-20	415	0.059	0.152	5mzhB.pdb.gz
4	AFDB:D6QUQ2	0.244	0.536	5.294E-20	463	0.066	0.151	D6QUQ2.pdb.gz	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
5	PDB:3jcmB	0.246	0.583	9.639E-20	429	0.050	0.124	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
6	AFDB:Q8N136	0.238	0.564	1.053E-19	415	0.053	0.137	Q8N136.pdb.gz	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
7	AFDB:Q8NBT0	0.245	0.599	1.110E-19	407	0.066	0.172	Q8NBT0.pdb.gz	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
8	AFDB:Q8N0X2	0.244	0.401	3.746E-19	631	0.052	0.087	Q8N0X2.pdb.gz	SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens OX=9606 GN=SPAG16 PE=1 SV=2
9	AFDB:P87177	0.244	0.281	5.720E-19	922	0.077	0.089	P87177.pdb.gz	YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3D6.12 PE=1 SV=1
10	PDB:7mqaLQ	0.243	0.309	7.994E-19	830	0.067	0.086	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:Q8K450	0.241	0.393	1.831E-18	639	0.052	0.086	Q8K450.pdb.gz	SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1
12	AFDB:Q9VU65	0.239	0.617	2.262E-18	391	0.043	0.118	Q9VU65.pdb.gz	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
13	AFDB:Q5A756	0.247	0.267	3.453E-18	981	0.067	0.072	Q5A756.pdb.gz	Q5A756_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DIP2 PE=4 SV=1
14	PDB:5yzgs	0.242	0.651	3.514E-18	374	0.055	0.158	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:3w15A	0.244	0.712	3.415E-17	336	0.062	0.196	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
16	PDB:3dm0A	0.241	0.372	3.601E-17	675	0.045	0.071	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
17	PDB:5o9zL	0.243	0.539	3.601E-17	459	0.042	0.098	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:5a2qg	0.239	0.760	5.214E-17	314	0.049	0.166	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
19	PDB:7pzyh	0.241	0.774	6.111E-17	311	0.046	0.158	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:7mq8LS	0.246	0.548	7.550E-17	453	0.050	0.117	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H2LP95	0.0	1217	1067	0.566	0.565	TBC31_ORYLA TBC1 domain family member 31 OS=Oryzias latipes OX=8090 GN=tbc1d31 PE=3 SV=2
2	Q96DN5	0.0	2221	1066	1.000	1.000	TBC31_HUMAN TBC1 domain family member 31 OS=Homo sapiens OX=9606 GN=TBC1D31 PE=1 SV=2
3	Q389W8	8.36e-30	130	1086	0.164	0.161	Q389W8_TRYB2 Rab-GAP TBC domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0190 PE=4 SV=1
4	Q9NDC9	1.10e-15	82.8	404	0.053	0.139	LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans OX=6239 GN=lis-1 PE=1 SV=1
5	Q09715	7.42e-11	68.6	614	0.082	0.142	TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup11 PE=1 SV=1
6	F4KB17	8.41e-10	65.5	839	0.057	0.073	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
7	Q8K450	4.03e-09	63.2	639	0.051	0.085	SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1
8	Q7T394	4.54e-09	62.4	410	0.051	0.132	LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio OX=7955 GN=pafah1b1a PE=2 SV=3
9	Q8N0X2	4.66e-09	62.8	631	0.049	0.082	SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens OX=9606 GN=SPAG16 PE=1 SV=2
10	Q803D2	1.63e-08	60.5	410	0.049	0.127	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
11	Q8H0T9	1.76e-08	61.2	837	0.056	0.072	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
12	P0CY34	3.17e-08	60.1	512	0.052	0.107	TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUP1 PE=2 SV=1
13	P43033	5.31e-08	58.9	410	0.048	0.124	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
14	P63004	5.65e-08	58.9	410	0.048	0.124	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
15	P63005	5.65e-08	58.9	410	0.048	0.124	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
16	P43034	6.16e-08	58.5	410	0.048	0.124	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
17	Q6FWR0	6.59e-08	59.3	643	0.041	0.068	Q6FWR0_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TUP1 PE=4 SV=1
18	O74184	9.00e-08	57.4	314	0.039	0.134	WAT1_SCHPO Target of rapamycin complex subunit wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop3 PE=1 SV=1
19	Q3Y8L7	1.74e-07	57.4	446	0.061	0.146	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
20	Q8C0J2	2.04e-07	57.4	607	0.060	0.105	A16L1_MOUSE Autophagy-related protein 16-1 OS=Mus musculus OX=10090 GN=Atg16l1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11666 DUF2933	2.3e+02	13.3	Protein of unknown function (DUF2933)
2	PF15492 Nbas_N	3.8e+02	11.8	Neuroblastoma-amplified sequence, N terminal
3	PF05567 Neisseria_PilC	42	14.6	Neisseria PilC beta-propeller domain
4	PF00566 RabGAP-TBC	0.00015	33.0	Rab-GTPase-TBC domain
5	PF00400 WD40	0.04	26.0	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257287	0.853	Centrosomal protein of 135 kDa
2	9606.ENSP00000344314	0.820	Oral-facial-digital syndrome 1 protein
3	9606.ENSP00000354791	0.811	Dynactin subunit 1
4	9606.ENSP00000432768	0.785	Cytoskeleton-associated protein 5
5	9606.ENSP00000252011	0.774	Probable ATP-dependent RNA helicase DHX35
6	9606.ENSP00000295124	0.767	Coiled-coil domain containing 138
7	9606.ENSP00000471454	0.754	Coiled-coil domain containing 61
8	9606.ENSP00000317144	0.745	Progesterone-induced-blocking factor 1
9	9606.ENSP00000309640	0.733	Xyloside xylosyltransferase 1
10	9606.ENSP00000293879	0.729	WD repeat-containing protein 90
11	9606.ENSP00000362639	0.720	Rab9 effector protein with kelch motifs
12	9606.ENSP00000428876	0.716	Protein FAM83A
13	9606.ENSP00000261597	0.712	Kinetochore protein NDC80 homolog
14	9606.ENSP00000338964	0.707	Glutathione hydrolase 7
15	9606.ENSP00000280020	0.691	Protein hinderin
16	9606.ENSP00000287394	0.675	ATPase family AAA domain-containing protein 2
17	9606.ENSP00000286398	0.672	Structural maintenance of chromosomes protein 2
18	9606.ENSP00000357858	0.659	Mitotic checkpoint protein BUB3
19	9606.ENSP00000323302	0.656	POC1 centriolar protein homolog B
20	9606.ENSP00000364721	0.651	Microtubule-associated protein RP/EB family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044085	0.996	cellular component biogenesis
GO:0016043	0.996	cellular component organization
GO:0044782	0.994	cilium organization
GO:0070925	0.990	organelle assembly
GO:0060271	0.982	cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0005813	0.998	centrosome
GO:0034451	0.989	centriolar satellite
GO:0036064	0.989	ciliary basal body
GO:0005737	0.828	cytoplasm
GO:0043231	0.655	intracellular membrane-bounded organelle
GO:0005829	0.590	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]