StarFunc result for job id Q96DN6

User Input

>input (1003 residues)
MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSYLLSDGTC
KCGLECPLNVPKVFNFDPLAPVTPGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSMETT
CSHSSPGEGASPQMFHTVSPGPPSARPPCRVPPTTPLNGGPGSLPPEPPSVSQAFPTLAG
PGGLFPPRLADPVPSGGSSSPRFLPRGNAPSPAPPPPPAISLNAPSYNWGAALRSSLVPS
DLGSPPAPHASSSPPSDPPLFHCSDALTPPPLPPSNNLPAHPGPASQPPVSSATMHLPLV
LGPLGGAPTVEGPGAPPFLASSLLSAAAKAQHPPLPPPSTLQGRRPRAQAPSASHSSSLR
PSQRRPRRPPTVFRLLEGRGPQTPRRSRPRAPAPVPQPFSLPEPSQPILPSVLSLLGLPT
PGPSHSDGSFNLLGSDAHLPPPPTLSSGSPPQPRHPIQPSLPGTTSGSLSSVPGAPAPPA
ASKAPVVPSPVLQSPSEGLGMGAGPACPLPPLAGGEAFPFPSPEQGLALSGAGFPGMLGA
LPLPLSLGQPPPSPLLNHSLFGVLTGGGGQPPPEPLLPPPGGPGPPLAPGEPEGPSLLVA
SLLPPPPSDLLPPPSAPPSNLLASFLPLLALGPTAGDGEGSAEGAGGPSGEPFSGLGDLS
PLLFPPLSAPPTLIALNSALLAATLDPPSGTPPQPCVLSAPQPGPPTSSVTTATTDPGAS
SLGKAPSNSGRPPQLLSPLLGASLLGDLSSLTSSPGALPSLLQPPGPLLSGQLGLQLLPG
GGAPPPLSEASSPLACLLQSLQIPPEQPEAPCLPPESPASALEPEPARPPLSALAPPHGS
PDPPVPELLTGRGSGKRGRRGGGGLRGINGEARPARGRKPGSRREPGRLALKWGTRGGFN
GQMERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPT
RNSNSSRQDITLEPSPTARAAVPLPPRARPGRPAKNKRRKLAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBA3	0.146	0.146	0.000	1003	1.000	1.000	A0A024RBA3.pdb.gz
2	AFDB:X1WFM6	0.123	0.098	2.244E-14	1320	0.299	0.227	X1WFM6.pdb.gz	X1WFM6_DANRE Methyl-CpG-binding domain protein 6 OS=Danio rerio OX=7955 GN=mbd6 PE=4 SV=1
3	AFDB:B1AYB6	0.107	0.080	3.564E-14	1498	0.248	0.166	B1AYB6.pdb.gz	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
4	AFDB:Q9HCH0	0.039	0.032	1.324E-2	1334	0.230	0.173	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
5	AFDB:Q9WUF3	0.044	0.030	1.098E-1	1962	0.136	0.069	Q9WUF3.pdb.gz	C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus OX=10090 GN=Casp8ap2 PE=1 SV=2
6	PDB:7ao8C	0.034	0.425	1.103E-1	64	0.014	0.219	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
7	AFDB:P20357	0.039	0.026	1.633E-1	1828	0.179	0.098	P20357.pdb.gz	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
8	AFDB:P18583	0.039	0.020	4.119E-1	2426	0.165	0.068	P18583.pdb.gz	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
9	AFDB:F1MAL5	0.053	0.048	5.733E-1	1327	0.221	0.167	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
10	AFDB:Q95RC8	0.034	0.031	5.733E-1	1280	0.136	0.106	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
11	AFDB:Q9XZ21	0.048	0.042	5.733E-1	1231	0.171	0.140	Q9XZ21.pdb.gz	Q9XZ21_DROME Something that sticks like glue, isoform A OS=Drosophila melanogaster OX=7227 GN=snama PE=1 SV=1
12	PDB:4v6wCH	0.026	0.129	8.013E-1	190	0.005	0.026	4v6wCH.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:5ltlB	0.030	0.232	9.145E-1	68	0.004	0.059	5ltlB.pdb.gz
14	PDB:2oghA	0.024	0.125	9.770E-1	108	0.017	0.157	2oghA.pdb.gz
15	PDB:1q67B	0.026	0.121	1.273	161	0.004	0.025	1q67B.pdb.gz
16	PDB:4qdlC	0.028	0.107	1.273	239	0.007	0.029	4qdlC.pdb.gz
17	PDB:5an9B	0.024	0.122	1.273	188	0.007	0.037	5an9B.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
18	PDB:7abzF	0.027	0.134	1.273	176	0.008	0.045	7abzF.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
19	PDB:1nmvA	0.027	0.139	1.360	163	0.005	0.031	1nmvA.pdb.gz
20	PDB:5yamA	0.022	0.210	1.453	69	0.005	0.072	5yamA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DN6	0.0	1848	1003	1.000	1.000	MBD6_HUMAN Methyl-CpG-binding domain protein 6 OS=Homo sapiens OX=9606 GN=MBD6 PE=1 SV=2
2	Q9P267	7.95e-38	156	1494	0.072	0.048	MBD5_HUMAN Methyl-CpG-binding domain protein 5 OS=Homo sapiens OX=9606 GN=MBD5 PE=1 SV=3
3	A0A1B0GW10	9.10e-38	156	1507	0.072	0.048	A0A1B0GW10_HUMAN Methyl-CpG binding domain protein 5 OS=Homo sapiens OX=9606 GN=MBD5 PE=4 SV=2
4	B1AYB6	1.24e-37	155	1498	0.071	0.047	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
5	X1WFM6	2.03e-33	142	1320	0.069	0.052	X1WFM6_DANRE Methyl-CpG-binding domain protein 6 OS=Danio rerio OX=7955 GN=mbd6 PE=4 SV=1
6	A2ASS6	0.69	36.6	35213	0.067	0.002	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	70	14.6	Methyl-CpG binding domain
2	PF14239 RRXRR	2.4e+02	13.0	RRXRR protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383920	0.956	Putative Polycomb group protein ASXL2
2	9606.ENSP00000332194	0.906	Histone H2A type 2-C
3	9606.ENSP00000297012	0.902	Histone H2A type 1-A
4	9606.ENSP00000355656	0.902	Histone H2A type 3
5	9606.ENSP00000367022	0.902	Histone H2A type 1-C
6	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000304697	0.900	Polyubiquitin-B
8	9606.ENSP00000328484	0.900	Histone H2A type 1-J
9	9606.ENSP00000332790	0.900	Histone H2A type 2-B
10	9606.ENSP00000341094	0.900	Histone H2A type 1-D
11	9606.ENSP00000366679	0.900	Histone H2A type 1-H
12	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
13	9606.ENSP00000441543	0.900	Polyubiquitin-C
14	9606.ENSP00000335677	0.862	Forkhead box protein K2
15	9606.ENSP00000297792	0.748	Lysine-specific histone demethylase 1B
16	9606.ENSP00000309555	0.741	Host cell factor 1
17	9606.ENSP00000417132	0.734	Ubiquitin carboxyl-terminal hydrolase BAP1
18	9606.ENSP00000328720	0.715	Forkhead box protein K1
19	9606.ENSP00000364839	0.709	Putative Polycomb group protein ASXL1
20	9606.ENSP00000242839	0.701	Copper-transporting ATPase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0097159	0.788	organic cyclic compound binding
GO:1901363	0.601	heterocyclic compound binding
GO:0003676	0.420	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.910	cellular process
GO:0050789	0.637	regulation of biological process
GO:0050794	0.582	regulation of cellular process
GO:0032502	0.444	developmental process
GO:0048856	0.403	anatomical structure development
GO:0019222	0.358	regulation of metabolic process
GO:0060255	0.339	regulation of macromolecule metabolic process
GO:0080090	0.306	regulation of primary metabolic process
GO:0010468	0.305	regulation of gene expression
GO:0051171	0.301	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0001650	0.998	fibrillar center
GO:0005737	0.575	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]