StarFunc result for job id Q96DR4

User Input

>input (205 residues)
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVID
DLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFS
YTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGM
IPQSAVDTAMASTLTNFYGDLRKAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DR4	1.000	1.000	1.164E-41	205	1.000	1.000	Q96DR4.pdb.gz	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
2	AFDB:Q99JV5	0.978	0.896	3.766E-37	224	0.859	0.786	Q99JV5.pdb.gz	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
3	PDB:6l1dA	0.966	0.990	1.990E-36	200	0.971	0.995	6l1dA.pdb.gz
4	PDB:5brlA	0.967	0.944	5.116E-36	210	0.859	0.838	5brlA.pdb.gz
5	PDB:2r55A	0.906	0.894	2.632E-21	208	0.322	0.317	2r55A.pdb.gz
6	AFDB:Q9NSY2	0.914	0.881	7.566E-21	213	0.317	0.305	Q9NSY2.pdb.gz	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
7	AFDB:Q61542	0.830	0.397	3.519E-15	446	0.220	0.101	Q61542.pdb.gz	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
8	AFDB:Q9DG10	0.879	0.640	4.394E-15	285	0.180	0.130	Q9DG10.pdb.gz	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
9	AFDB:P49675	0.868	0.631	6.481E-15	285	0.171	0.123	P49675.pdb.gz	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
10	AFDB:P51557	0.858	0.627	3.625E-14	284	0.166	0.120	P51557.pdb.gz	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
11	AFDB:J3QLM1	0.713	0.323	9.317E-14	475	0.195	0.084	J3QLM1.pdb.gz	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
12	AFDB:Q57ZK9	0.811	0.468	2.914E-12	369	0.151	0.084	Q57ZK9.pdb.gz	Q57ZK9_TRYB2 START domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.510 PE=4 SV=1
13	AFDB:Q9EQG9	0.763	0.275	2.914E-12	624	0.185	0.061	Q9EQG9.pdb.gz	CERT_MOUSE Ceramide transfer protein OS=Mus musculus OX=10090 GN=Cert1 PE=1 SV=1
14	PDB:6serA	0.779	0.661	1.104E-11	245	0.151	0.127	6serA.pdb.gz
15	PDB:1ln1A	0.739	0.745	3.266E-10	203	0.166	0.167	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
16	PDB:3ojiB	0.499	0.544	1.359E-4	185	0.102	0.114	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism
17	PDB:3kdhA	0.530	0.568	4.362E-4	189	0.088	0.095	3kdhA.pdb.gz
18	PDB:3nefA	0.400	0.442	4.362E-4	182	0.073	0.082	3nefA.pdb.gz	Functional mechanism of the ABA agonist pyrabactin
19	PDB:3k3kB	0.498	0.545	8.035E-4	183	0.102	0.115	3k3kB.pdb.gz	Structural mechanism of abscisic acid binding and signaling by dimeric PYR1.
20	PDB:1ifvA	0.371	0.465	1.480E-3	155	0.063	0.084	1ifvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DR4	8.16e-156	431	205	1.000	1.000	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
2	Q99JV5	2.18e-136	382	224	0.863	0.790	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
3	Q9NSY2	7.47e-39	134	213	0.322	0.310	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
4	Q14849	1.92e-13	70.1	445	0.180	0.083	STAR3_HUMAN StAR-related lipid transfer protein 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=2
5	Q61542	3.90e-12	66.6	446	0.176	0.081	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
6	Q9DG10	1.29e-08	55.8	285	0.156	0.112	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
7	P51557	2.25e-08	55.1	284	0.180	0.130	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
8	J3QLM1	4.02e-08	54.7	475	0.146	0.063	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
9	P97826	8.59e-08	53.1	284	0.151	0.109	STAR_RAT Steroidogenic acute regulatory protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Star PE=1 SV=1
10	P49675	1.25e-07	52.8	285	0.180	0.130	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
11	Q8MLN9	1.7	32.0	911	0.146	0.033	Q8MLN9_DROME Prominin, isoform C OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=2
12	Q06PM6	1.8	32.0	910	0.146	0.033	Q06PM6_DROME Prominin OS=Drosophila melanogaster OX=7227 GN=prom PE=2 SV=1
13	A0AVW1	1.9	32.0	1066	0.141	0.027	A0AVW1_DROME IP13255p OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
14	Q9NQZ5	2.4	31.2	370	0.078	0.043	STAR7_HUMAN StAR-related lipid transfer protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=STARD7 PE=1 SV=2
15	A0A0B4LGM0	2.6	31.6	1173	0.141	0.025	A0A0B4LGM0_DROME Prominin, isoform E OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
16	B7YZQ3	2.9	31.2	1235	0.141	0.023	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
17	Q8R1R3	4.2	30.4	373	0.078	0.043	STAR7_MOUSE StAR-related lipid transfer protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Stard7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01852 START	3.2e-11	54.6	START domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276449	0.926	Steroidogenic acute regulatory protein, mitochondrial
2	9606.ENSP00000268896	0.769	Phosphatidylcholine transfer protein
3	9606.ENSP00000269886	0.670	Endophilin-A2
4	9606.ENSP00000478305	0.667	Spermine oxidase
5	9606.ENSP00000368066	0.650	Hydroxyacid oxidase 1
6	9606.ENSP00000363727	0.637	StAR-related lipid transfer protein 8
7	9606.ENSP00000368766	0.628	Alpha-1D adrenergic receptor
8	9606.ENSP00000337446	0.620	StAR-related lipid transfer protein 3
9	9606.ENSP00000423067	0.616	WD repeat-containing protein 36
10	9606.ENSP00000338030	0.610	StAR-related lipid transfer protein 7, mitochondrial
11	9606.ENSP00000338785	0.607	StAR-related lipid transfer protein 13
12	9606.ENSP00000354476	0.590	Sterol regulatory element-binding protein 2
13	9606.ENSP00000278353	0.581	Very-long-chain 3-oxoacyl-CoA reductase
14	9606.ENSP00000282356	0.576	Calcium/calmodulin-dependent protein kinase type IV
15	9606.ENSP00000477707	0.573	Oxysterols receptor LXR-alpha
16	9606.ENSP00000348069	0.572	Sterol regulatory element-binding protein 1
17	9606.ENSP00000340507	0.571	Transcription intermediary factor 1-alpha
18	9606.ENSP00000344741	0.560	Insulin-induced gene 1 protein
19	9606.ENSP00000254037	0.555	Zinc finger CCHC domain-containing protein 9
20	9606.ENSP00000303246	0.554	Acyl-coenzyme A thioesterase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0120020	1.000	cholesterol transfer activity
GO:0015485	1.000	cholesterol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062013	0.995	positive regulation of small molecule metabolic process
GO:0050810	0.995	regulation of steroid biosynthetic process
GO:0046889	0.995	positive regulation of lipid biosynthetic process
GO:0032365	0.995	intracellular lipid transport
GO:0010565	0.994	regulation of cellular ketone metabolic process
GO:0010893	0.994	positive regulation of steroid biosynthetic process
GO:0051235	0.992	maintenance of location
GO:0090181	0.979	regulation of cholesterol metabolic process
GO:0030301	0.976	cholesterol transport
GO:0019915	0.971	lipid storage
GO:0048522	0.956	positive regulation of cellular process
GO:0031328	0.950	positive regulation of cellular biosynthetic process
GO:0071704	0.412	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005829	0.956	cytosol
GO:0031982	0.911	vesicle
GO:0005739	0.765	mitochondrion
GO:0005783	0.759	endoplasmic reticulum
GO:0097708	0.592	intracellular vesicle
GO:0031410	0.569	cytoplasmic vesicle
GO:0070013	0.425	intracellular organelle lumen
GO:0016020	0.412	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	1.000	cholesterol(in) = cholesterol(out)

[back to server]