StarFunc result for job id Q96DR7

User Input

>input (871 residues)
MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLL
AAQIPAQVPTASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAV
PGGSPKSPANGAVTLPAPPPPPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAA
NNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSP
AALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRI
KKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTER
HHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQ
RTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRG
ELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNE
ELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHS
SGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF
PMECAKEITCQATIDKNVERMGRLLGLETNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DR7	1.000	1.000	0.000	871	1.000	1.000	Q96DR7.pdb.gz	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
2	AFDB:D3YYY8	0.612	0.613	3.483E-104	869	0.866	0.868	D3YYY8.pdb.gz	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
3	AFDB:Q5VV41	0.531	0.644	7.417E-58	709	0.348	0.427	Q5VV41.pdb.gz	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
4	AFDB:Q5I1Y9	0.458	0.717	5.539E-43	533	0.209	0.341	Q5I1Y9.pdb.gz	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:Q12774	0.480	0.270	7.031E-43	1597	0.277	0.151	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
6	AFDB:Q9Y7U6	0.337	0.228	3.402E-24	1334	0.193	0.126	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
7	AFDB:Q96PE2	0.281	0.135	5.502E-17	2063	0.162	0.068	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
8	AFDB:Q8IQ97	0.327	0.223	8.452E-17	1311	0.161	0.107	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
9	PDB:7rx9A	0.203	0.398	1.468E-15	432	0.086	0.174	7rx9A.pdb.gz
10	AFDB:Q6ZNL6	0.236	0.147	2.271E-15	1462	0.163	0.097	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
11	PDB:4mt6A	0.276	0.531	4.611E-15	389	0.079	0.177	4mt6A.pdb.gz
12	AFDB:Q6XZF7	0.220	0.124	3.955E-10	1577	0.129	0.071	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
13	PDB:4gouA	0.193	0.321	4.918E-9	507	0.060	0.103	4gouA.pdb.gz
14	PDB:6u3eA	0.111	0.206	7.076E-4	397	0.055	0.121	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:2dybA	0.067	0.191	9.420E-4	298	0.029	0.084	2dybA.pdb.gz
16	PDB:3ljuX	0.101	0.220	1.254E-3	373	0.028	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6hhgA	0.094	0.200	1.254E-3	386	0.031	0.070	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:5yqrA	0.104	0.271	1.447E-3	268	0.042	0.138	5yqrA.pdb.gz
19	PDB:1griA	0.071	0.273	1.837E-3	211	0.033	0.137	1griA.pdb.gz
20	PDB:6s9wA	0.096	0.191	2.445E-3	411	0.030	0.063	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YYY8	0.0	1517	869	0.867	0.869	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
2	Q96DR7	0.0	1791	871	1.000	1.000	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
3	F6TAL7	7.77e-176	509	257	0.282	0.957	F6TAL7_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 (Fragment) OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
4	Q5VV41	3.06e-175	525	709	0.357	0.439	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
5	Q5I1Y9	5.07e-96	313	533	0.197	0.323	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q5BKC9	1.96e-95	316	701	0.195	0.243	NGEF_RAT Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE=1 SV=2
7	Q8CHT1	2.32e-94	314	710	0.194	0.238	NGEF_MOUSE Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV=1
8	Q8N5V2	4.22e-94	313	710	0.199	0.244	NGEF_HUMAN Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=2
9	E9Q7D5	8.15e-86	302	1581	0.196	0.108	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
10	A0A090N7S2	2.34e-83	279	519	0.186	0.312	A0A090N7S2_HUMAN Rho guanine nucleotide exchange factor (GEF) 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=4 SV=1
11	Q12774	1.32e-81	290	1597	0.189	0.103	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
12	E7EY47	3.35e-81	283	958	0.195	0.177	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
13	Q8BWA8	1.06e-79	276	802	0.184	0.200	ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus OX=10090 GN=Arhgef19 PE=1 SV=1
14	Q8IW93	4.27e-79	275	802	0.181	0.197	ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens OX=9606 GN=ARHGEF19 PE=1 SV=1
15	Q9Y150	9.95e-74	264	1051	0.192	0.159	Q9Y150_DROME BcDNA.GH03693 OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=1
16	Q9VVC6	2.18e-72	263	2029	0.192	0.082	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
17	H0Y895	2.26e-56	210	797	0.131	0.143	H0Y895_HUMAN Rho guanine nucleotide exchange factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=1
18	O94989	1.12e-51	197	841	0.179	0.185	ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens OX=9606 GN=ARHGEF15 PE=1 SV=4
19	A0A0G2JTU0	1.71e-50	193	850	0.180	0.185	A0A0G2JTU0_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
20	Q5FWH6	8.82e-50	191	849	0.180	0.185	ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus OX=10090 GN=Arhgef15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	1	20.7	PH domain
2	PF00169 PH	0.032	26.1	PH domain
3	PF00621 RhoGEF	5.8e-34	129.4	RhoGEF domain
4	PF00018 SH3_1	3.9e-07	40.9	SH3 domain
5	PF07653 SH3_2	2.3e-05	35.4	Variant SH3 domain
6	PF14604 SH3_9	1.5e-05	36.2	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339467	0.961	Rho-related GTP-binding protein RhoG
2	9606.ENSP00000264832	0.900	Intercellular adhesion molecule 1
3	9606.ENSP00000371211	0.755	Transmembrane protease serine 6
4	9606.ENSP00000376345	0.708	Growth factor receptor-bound protein 2
5	9606.ENSP00000380019	0.633	Zinc finger protein 384
6	9606.ENSP00000383118	0.575	Cell division control protein 42 homolog
7	9606.ENSP00000280333	0.539	Dedicator of cytokinesis protein 1
8	9606.ENSP00000248114	0.520	FAD-linked sulfhydryl oxidase ALR
9	9606.ENSP00000380659	0.518	Eukaryotic translation initiation factor 4E transporter
10	9606.ENSP00000326737	0.513	Tumor necrosis factor receptor superfamily member 12A
11	9606.ENSP00000256151	0.506	Thyroid transcription factor 1-associated protein 26
12	9606.ENSP00000367355	0.506	Rho guanine nucleotide exchange factor 35
13	9606.ENSP00000328083	0.502	Rho guanine nucleotide exchange factor 37
14	9606.ENSP00000349486	0.502	Protein scribble homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.865	enzyme binding
GO:0019904	0.828	protein domain specific binding
GO:0005102	0.763	signaling receptor binding
GO:0051020	0.700	GTPase binding
GO:0031267	0.680	small GTPase binding
GO:0019901	0.639	protein kinase binding
GO:1990782	0.469	protein tyrosine kinase binding
GO:0030971	0.425	receptor tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0016043	0.968	cellular component organization
GO:0050794	0.884	regulation of cellular process
GO:0048856	0.838	anatomical structure development
GO:0030855	0.782	epithelial cell differentiation
GO:0022607	0.720	cellular component assembly
GO:0050896	0.660	response to stimulus
GO:0048518	0.652	positive regulation of biological process
GO:0009653	0.650	anatomical structure morphogenesis
GO:0048522	0.639	positive regulation of cellular process
GO:0000904	0.575	cell morphogenesis involved in differentiation
GO:0030030	0.503	cell projection organization
GO:0048583	0.489	regulation of response to stimulus
GO:0051716	0.459	cellular response to stimulus
GO:0120036	0.458	plasma membrane bounded cell projection organization
GO:0023051	0.426	regulation of signaling
GO:0009966	0.411	regulation of signal transduction
GO:1902531	0.388	regulation of intracellular signal transduction
GO:0003158	0.342	endothelium development
GO:0002064	0.318	epithelial cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.948	plasma membrane
GO:0043226	0.768	organelle
GO:0043229	0.747	intracellular organelle
GO:0043231	0.382	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]