StarFunc result for job id Q96DT5

User Input

>input (1400 residues)
MAAQVAAREARDFREAPTLRLTSGAGLEAVGAVELEEEEENEEEAAARRARSFAQDARVR
FLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSPACLVFSFAASGRLAASQEIPR
DANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEILVPVLSNKNNHKSW
SCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIIL
HAIESVVIEWSHQIQEIIERDSVQRLLNGLHLSPQAELDFWMMRRENLSCIYDQLQAPVV
LKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQCLQETEFPQTRIL
IAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKV
QVAVNILKTFKNSFFNYRKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFAT
TLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTNMEFESDYVAF
KSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFN
TELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFL
GNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCVNF
DPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEV
EYPLIEDELRAIDEQLTAATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQT
MRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPS
LDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPS
LDREAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRV
VNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIPEQPPTLE
QFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVI
DSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLL
ESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAE
FRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCR
KEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAY
TGLEGTVKDMTASLRAITEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUQ6	0.387	0.829	9.034E-40	614	0.148	0.337	A0A0R4IUQ6.pdb.gz
2	AFDB:Q5SX07	0.302	0.872	9.126E-30	457	0.137	0.420	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
3	PDB:7z8fe	0.359	0.132	3.864E-29	4579	0.131	0.040	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
4	PDB:7kzmC	0.256	0.119	2.357E-15	3890	0.134	0.048	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	PDB:7z8jf	0.280	0.499	4.385E-11	674	0.072	0.150	7z8jf.pdb.gz
6	AFDB:Q9VN30	0.200	0.250	2.989E-9	1079	0.074	0.095	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
7	AFDB:Q8BXT7	0.113	0.666	3.348E-8	203	0.036	0.251	Q8BXT7.pdb.gz	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
8	PDB:7qenD	0.069	0.082	4.584E-4	1050	0.111	0.148	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
9	PDB:7mq8LM	0.093	0.074	4.779E-4	2005	0.112	0.078	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:6vaeA	0.069	0.077	7.249E-4	1198	0.106	0.124	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
11	PDB:6bcuA	0.067	0.054	1.890E-3	2204	0.118	0.075	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
12	AFDB:Q4FZC9	0.073	0.093	3.735E-3	975	0.087	0.125	Q4FZC9.pdb.gz	SYNE3_MOUSE Nesprin-3 OS=Mus musculus OX=10090 GN=Syne3 PE=1 SV=1
13	PDB:8a2qB	0.089	0.104	4.170E-3	1084	0.091	0.118	8a2qB.pdb.gz
14	AFDB:Q21408	0.077	0.046	4.232E-3	2432	0.110	0.063	Q21408.pdb.gz	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
15	PDB:5h64A	0.063	0.050	4.926E-3	2101	0.119	0.079	5h64A.pdb.gz
16	PDB:7qdrB	0.060	0.067	4.926E-3	1212	0.113	0.130	7qdrB.pdb.gz
17	AFDB:Q6ZMZ3	0.079	0.096	5.905E-3	975	0.083	0.119	Q6ZMZ3.pdb.gz	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
18	AFDB:P02549	0.087	0.058	7.905E-3	2419	0.106	0.062	P02549.pdb.gz	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
19	AFDB:P13395	0.095	0.060	1.199E-2	2415	0.121	0.070	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
20	AFDB:E0AHA7	0.091	0.061	3.397E-2	2326	0.127	0.077	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHJ4	0.0	887	4496	0.334	0.104	A0A0B4KHJ4_DROME Dynein heavy chain at 93AB, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc93AB PE=3 SV=1
2	B1AR51	0.0	1120	4484	0.407	0.127	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
3	E9Q7N9	0.0	2228	4488	0.767	0.239	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
4	F1SC07	0.0	2401	4518	0.832	0.258	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4
5	Q69Z23	0.0	1033	4481	0.371	0.116	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
6	Q96DT5	0.0	2905	4516	1.000	0.310	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
7	Q9NYC9	0.0	1098	4486	0.400	0.125	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
8	Q9QZH1	0.0	2226	4488	0.766	0.239	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
9	Q9UFH2	0.0	1066	4462	0.376	0.118	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
10	Q7SY17	1.00e-126	408	614	0.145	0.331	Q7SY17_DANRE Dynein, axonemal, heavy chain 9 OS=Danio rerio OX=7955 GN=Lrdr PE=1 SV=1
11	Q5SX07	4.26e-119	382	457	0.137	0.420	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
12	Q386I6	9.32e-99	353	4658	0.245	0.074	Q386I6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0760 PE=4 SV=1
13	Q5LJN5	1.85e-66	251	4559	0.114	0.035	Q5LJN5_DROME Male fertility factor kl5 OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=3 SV=4
14	Q9U3Y5	2.64e-65	248	4559	0.111	0.034	Q9U3Y5_DROME Dynein heavy chain OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=2 SV=1
15	Q9MBF8	2.28e-62	238	4513	0.211	0.065	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
16	Q39575	9.00e-52	204	4485	0.194	0.061	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
17	D3YYQ8	2.97e-39	163	4591	0.168	0.051	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
18	Q8TE73	9.97e-35	148	4624	0.121	0.037	DYH5_HUMAN Dynein axonemal heavy chain 5 OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3
19	Q8VHE6	1.44e-33	144	4621	0.104	0.032	DYH5_MOUSE Dynein axonemal heavy chain 5 OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2
20	Q96JB1	1.72e-33	144	4490	0.096	0.030	DYH8_HUMAN Dynein axonemal heavy chain 8 OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08385 DHC_N1	7e-159	541.7	Dynein heavy chain, N-terminal region 1
2	PF08393 DHC_N2	2.4e-08	45.1	Dynein heavy chain, N-terminal region 2
3	PF14774 FAM177	86	15.0	FAM177 family
4	PF16752 TBCC_N	1.6e+02	14.1	Tubulin-specific chaperone C N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475939

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480538	0.914	Dynein intermediate chain 1, axonemal
2	9606.ENSP00000354791	0.876	Dynactin subunit 1
3	9606.ENSP00000400252	0.861	Dynein intermediate chain 2, axonemal
4	9606.ENSP00000408910	0.861	Dynactin subunit 2
5	9606.ENSP00000380679	0.835	Coiled-coil domain-containing protein 40
6	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
7	9606.ENSP00000289228	0.820	Beta-centractin
8	9606.ENSP00000358921	0.820	Alpha-centractin
9	9606.ENSP00000414906	0.807	Dynactin subunit 4
10	9606.ENSP00000300087	0.804	Dynactin subunit 5
11	9606.ENSP00000391692	0.804	Coiled-coil domain containing 103
12	9606.ENSP00000259632	0.803	Dynactin subunit 3
13	9606.ENSP00000199447	0.802	Thioredoxin domain-containing protein 3
14	9606.ENSP00000334002	0.802	Huntingtin-associated protein 1
15	9606.ENSP00000361238	0.801	Radial spoke head 9 homolog
16	9606.ENSP00000221114	0.800	Dynactin subunit 6
17	9606.ENSP00000405708	0.799	Coiled-coil domain-containing protein 39
18	9606.ENSP00000391869	0.795	annotation not available
19	9606.ENSP00000229554	0.794	Radial spoke head protein 4 homolog A
20	9606.ENSP00000298292	0.791	Protein kintoun

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048870	0.995	cell motility
GO:0003341	0.995	cilium movement
GO:0030317	0.993	flagellated sperm motility
GO:0051179	0.954	localization
GO:0060972	0.906	left/right pattern formation
GO:0007368	0.730	determination of left/right symmetry

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0097729	1.000	9+2 motile cilium
GO:0005930	1.000	axoneme
GO:0032991	0.479	protein-containing complex
GO:1902494	0.388	catalytic complex
GO:0120135	0.358	distal portion of axoneme
GO:0036157	0.350	outer dynein arm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]