StarFunc result for job id Q96DU3

User Input

>input (332 residues)
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS
SYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF
IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP
RENDTITIYSTINHSKESKPTFSRATALDNVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DU3	1.000	1.000	2.958E-56	332	1.000	1.000	Q96DU3.pdb.gz	SLAF6_HUMAN SLAM family member 6 OS=Homo sapiens OX=9606 GN=SLAMF6 PE=1 SV=3
2	AFDB:Q9ET39	0.617	0.585	1.838E-28	351	0.422	0.399	Q9ET39.pdb.gz	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
3	AFDB:Q18PI6	0.528	0.533	2.995E-22	329	0.271	0.274	Q18PI6.pdb.gz	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
4	AFDB:Q8BHK6	0.623	0.621	3.903E-22	333	0.259	0.258	Q8BHK6.pdb.gz	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
5	AFDB:Q9UIB8	0.559	0.539	9.111E-22	345	0.289	0.278	Q9UIB8.pdb.gz	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
6	AFDB:Q9D780	0.536	0.618	2.188E-20	285	0.232	0.270	Q9D780.pdb.gz	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
7	AFDB:Q9NQ25	0.514	0.510	2.432E-20	335	0.259	0.257	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
8	AFDB:Q01965	0.493	0.264	1.638E-19	654	0.262	0.133	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
9	AFDB:Q96A28	0.498	0.567	1.976E-18	289	0.211	0.242	Q96A28.pdb.gz	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
10	AFDB:Q9HBG7	0.493	0.262	3.731E-18	655	0.238	0.121	Q9HBG7.pdb.gz	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
11	PDB:6dlfA	0.307	0.400	7.716E-8	236	0.120	0.169	6dlfA.pdb.gz
12	PDB:6dldD	0.346	0.410	1.179E-7	269	0.090	0.112	6dldD.pdb.gz
13	PDB:1fdlL	0.226	0.317	2.901E-7	214	0.117	0.182	1fdlL.pdb.gz
14	PDB:5c7kF	0.214	0.306	3.401E-7	212	0.087	0.137	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
15	PDB:3o3uN	0.352	0.214	5.196E-7	580	0.084	0.048	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
16	PDB:1a8jL	0.217	0.318	7.140E-7	216	0.127	0.194	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
17	PDB:1aqkL	0.209	0.306	7.938E-7	216	0.117	0.181	1aqkL.pdb.gz
18	PDB:6dcvA	0.211	0.301	9.306E-7	220	0.105	0.159	6dcvA.pdb.gz
19	PDB:1cf8L	0.231	0.332	1.853E-6	215	0.111	0.172	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
20	PDB:3tygL	0.233	0.332	1.853E-6	207	0.127	0.203	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DU3	0.0	684	332	1.000	1.000	SLAF6_HUMAN SLAM family member 6 OS=Homo sapiens OX=9606 GN=SLAMF6 PE=1 SV=3
2	Q9ET39	1.47e-73	233	351	0.440	0.416	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
3	Q9UIB8	7.84e-32	124	345	0.271	0.261	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
4	Q18PI6	9.91e-32	123	329	0.277	0.280	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
5	Q8BHK6	1.43e-27	112	333	0.313	0.312	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
6	Q9D780	4.20e-27	109	285	0.214	0.249	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
7	Q96A28	1.00e-25	106	289	0.211	0.242	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
8	Q9HBG7	4.18e-25	108	655	0.253	0.128	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
9	Q9NQ25	4.39e-21	94.4	335	0.280	0.278	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
10	Q01965	1.05e-20	95.1	654	0.256	0.130	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
11	Q5VYH9	2.73e-20	93.6	565	0.247	0.145	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
12	Q13291	1.60e-09	60.5	335	0.244	0.242	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
13	Q07763	4.84e-07	53.1	397	0.142	0.118	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
14	B4DW98	9.93e-07	51.6	241	0.099	0.137	B4DW98_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
15	Q9QUM4	1.24e-06	52.0	343	0.169	0.163	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
16	P15151	4.52e-05	47.4	417	0.136	0.108	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
17	Q9JHQ1	7.33e-05	46.6	362	0.102	0.094	Q9JHQ1_RAT Titin (Fragment) OS=Rattus norvegicus OX=10116 GN=Ttn PE=2 SV=1
18	Q8BVF6	1.48e-04	45.4	408	0.120	0.098	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
19	Q8K094	1.52e-04	45.4	408	0.120	0.098	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
20	Q91WP1	1.53e-04	45.4	408	0.120	0.098	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.0034	28.8	Immunoglobulin I-set domain
2	PF00047 ig	0.003	29.0	Immunoglobulin domain
3	PF13895 Ig_2	0.038	25.6	Immunoglobulin domain
4	PF13927 Ig_3	7.2e-05	34.6	Immunoglobulin domain
5	PF04277 OAD_gamma	1.6e+02	14.3	Oxaloacetate decarboxylase, gamma chain
6	PF16820 PKD_3	1.6e+02	13.6	PKD-like domain
7	PF07686 V-set	0.00011	33.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360181	0.967	SH2 domain-containing protein 1A
2	9606.ENSP00000356906	0.949	SH2 domain-containing protein 1B
3	9606.ENSP00000240618	0.846	Killer cell lectin-like receptor subfamily K, member 1
4	9606.ENSP00000356320	0.839	UL16-binding protein 2
5	9606.ENSP00000484431	0.821	CD48 antigen
6	9606.ENSP00000340944	0.810	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000280200	0.771	CD226 antigen
8	9606.ENSP00000337825	0.767	Tyrosine-protein kinase Lck
9	9606.ENSP00000342156	0.766	Natural cytotoxicity triggering receptor 3
10	9606.ENSP00000357012	0.749	Natural killer cell receptor 2B4
11	9606.ENSP00000483713	0.745	Killer cell lectin-like receptor subfamily F member 1
12	9606.ENSP00000346671	0.732	Tyrosine-protein kinase Fyn
13	9606.ENSP00000228438	0.712	C-type lectin domain family 2 member B
14	9606.ENSP00000480609	0.705	annotation not available
15	9606.ENSP00000362181	0.694	Natural cytotoxicity triggering receptor 2
16	9606.ENSP00000402060	0.689	Poliovirus receptor
17	9606.ENSP00000438038	0.679	NKG2-A/NKG2-B type II integral membrane protein
18	9606.ENSP00000252483	0.678	Nectin-2
19	9606.ENSP00000371333	0.648	Natural killer cells antigen CD94
20	9606.ENSP00000354782	0.645	T-cell surface glycoprotein CD3 zeta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0046649	0.990	lymphocyte activation
GO:0050778	0.987	positive regulation of immune response
GO:0045088	0.980	regulation of innate immune response
GO:0002521	0.977	leukocyte differentiation
GO:0031341	0.970	regulation of cell killing
GO:0051240	0.970	positive regulation of multicellular organismal process
GO:0031349	0.970	positive regulation of defense response
GO:0048522	0.967	positive regulation of cellular process
GO:0042110	0.967	T cell activation
GO:0042269	0.964	regulation of natural killer cell mediated cytotoxicity
GO:0031343	0.961	positive regulation of cell killing
GO:0002708	0.957	positive regulation of lymphocyte mediated immunity
GO:0002366	0.956	leukocyte activation involved in immune response
GO:0001912	0.947	positive regulation of leukocyte mediated cytotoxicity
GO:0002285	0.945	lymphocyte activation involved in immune response
GO:0001817	0.937	regulation of cytokine production
GO:0045089	0.936	positive regulation of innate immune response
GO:0030098	0.934	lymphocyte differentiation
GO:0001819	0.932	positive regulation of cytokine production
GO:0045954	0.907	positive regulation of natural killer cell mediated cytotoxicity
GO:0030217	0.897	T cell differentiation
GO:0046631	0.850	alpha-beta T cell activation
GO:0002286	0.842	T cell activation involved in immune response
GO:0032729	0.839	positive regulation of type II interferon production
GO:0045058	0.826	T cell selection
GO:0002250	0.734	adaptive immune response
GO:0035710	0.733	CD4-positive, alpha-beta T cell activation
GO:0002287	0.721	alpha-beta T cell activation involved in immune response
GO:0002292	0.721	T cell differentiation involved in immune response
GO:0046632	0.654	alpha-beta T cell differentiation
GO:0051716	0.557	cellular response to stimulus
GO:0002694	0.449	regulation of leukocyte activation
GO:0023052	0.406	signaling
GO:0007154	0.406	cell communication
GO:0002460	0.379	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0007165	0.376	signal transduction
GO:0048519	0.348	negative regulation of biological process
GO:0043367	0.348	CD4-positive, alpha-beta T cell differentiation
GO:0045165	0.327	cell fate commitment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0031982	0.992	vesicle
GO:0005576	0.990	extracellular region
GO:0043230	0.978	extracellular organelle
GO:0005615	0.962	extracellular space
GO:1903561	0.937	extracellular vesicle
GO:0070062	0.929	extracellular exosome
GO:0005622	0.898	intracellular anatomical structure
GO:0043229	0.807	intracellular organelle
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0005737	0.672	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]