StarFunc result for job id Q96DW6

User Input

>input (304 residues)
MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQP
SDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHP
PTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSG
LTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADV
IKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKM
GLKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DW6	1.000	1.000	3.890E-39	304	1.000	1.000	Q96DW6.pdb.gz	S2538_HUMAN Mitochondrial glycine transporter OS=Homo sapiens OX=9606 GN=SLC25A38 PE=1 SV=1
2	AFDB:Q91XD8	0.945	0.882	2.570E-33	326	0.859	0.801	Q91XD8.pdb.gz	S2538_MOUSE Mitochondrial glycine transporter OS=Mus musculus OX=10090 GN=Slc25a38 PE=2 SV=1
3	AFDB:P0CAT2	0.893	0.945	3.789E-26	287	0.579	0.613	P0CAT2.pdb.gz	S238B_DANRE Mitochondrial glycine transporter B OS=Danio rerio OX=7955 GN=slc25a38b PE=2 SV=2
4	AFDB:Q08CI8	0.906	0.958	7.810E-26	287	0.566	0.599	Q08CI8.pdb.gz	S238A_DANRE Mitochondrial glycine transporter A OS=Danio rerio OX=7955 GN=slc25a38a PE=2 SV=2
5	AFDB:Q9P6N6	0.759	0.778	4.815E-15	296	0.312	0.321	Q9P6N6.pdb.gz	S2538_SCHPO Mitochondrial glycine transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC823.10c PE=3 SV=1
6	AFDB:P10566	0.780	0.756	7.649E-14	314	0.250	0.242	P10566.pdb.gz	MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS3 PE=1 SV=4
7	AFDB:Q07534	0.786	0.778	1.170E-13	307	0.316	0.313	Q07534.pdb.gz	S2538_YEAST Mitochondrial glycine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM25 PE=1 SV=1
8	AFDB:O64731	0.807	0.744	1.221E-13	331	0.227	0.208	O64731.pdb.gz	O64731_ARATH Mitochondrial substrate carrier family protein OS=Arabidopsis thaliana OX=3702 GN=MIT1 PE=1 SV=1
9	AFDB:Q8L6Z2	0.811	0.759	5.413E-13	326	0.250	0.233	Q8L6Z2.pdb.gz	Q8L6Z2_ARATH At1g07030 OS=Arabidopsis thaliana OX=3702 GN=MIT2 PE=1 SV=1
10	AFDB:B4F8I5	0.767	0.701	5.894E-13	335	0.237	0.215	B4F8I5.pdb.gz	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
11	PDB:2c3eA	0.722	0.746	5.330E-10	293	0.191	0.198	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.739	0.772	1.830E-9	290	0.158	0.166	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.485	0.500	6.736E-6	292	0.181	0.188	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2lckA	0.478	0.486	2.025E-4	297	0.234	0.239	2lckA.pdb.gz
15	PDB:5k3iA	0.171	0.095	2.923E-1	661	0.125	0.057	5k3iA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
16	PDB:1w07B	0.172	0.100	5.534E-1	658	0.128	0.059	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism
17	PDB:5mkkB	0.178	0.115	5.774E-1	577	0.135	0.071	5mkkB.pdb.gz
18	PDB:2nq2A	0.158	0.156	6.287E-1	308	0.112	0.110	2nq2A.pdb.gz
19	PDB:7s5xE	0.165	0.061	7.453E-1	1412	0.125	0.027	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
20	PDB:6s7tA	0.149	0.086	7.777E-1	706	0.141	0.061	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91XD8	0.0	541	326	0.868	0.810	S2538_MOUSE Mitochondrial glycine transporter OS=Mus musculus OX=10090 GN=Slc25a38 PE=2 SV=1
2	Q96DW6	0.0	624	304	1.000	1.000	S2538_HUMAN Mitochondrial glycine transporter OS=Homo sapiens OX=9606 GN=SLC25A38 PE=1 SV=1
3	P0CAT2	4.11e-133	381	287	0.586	0.620	S238B_DANRE Mitochondrial glycine transporter B OS=Danio rerio OX=7955 GN=slc25a38b PE=2 SV=2
4	Q08CI8	2.47e-128	369	287	0.566	0.599	S238A_DANRE Mitochondrial glycine transporter A OS=Danio rerio OX=7955 GN=slc25a38a PE=2 SV=2
5	Q9P6N6	8.00e-47	161	296	0.312	0.321	S2538_SCHPO Mitochondrial glycine transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC823.10c PE=3 SV=1
6	Q07534	2.25e-33	126	307	0.319	0.316	S2538_YEAST Mitochondrial glycine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM25 PE=1 SV=1
7	P10566	3.94e-29	115	314	0.273	0.264	MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS3 PE=1 SV=4
8	Q8BZ09	3.76e-27	109	298	0.266	0.272	ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a21 PE=1 SV=1
9	Q9VWG0	1.27e-26	109	387	0.243	0.191	SHAWN_DROME Solute carrier family 25 protein Shawn OS=Drosophila melanogaster OX=7227 GN=Shawn PE=1 SV=2
10	B4F8I5	1.62e-26	108	335	0.247	0.224	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
11	P79110	2.52e-26	107	311	0.260	0.254	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1
12	Q8BGP6	6.23e-25	104	337	0.273	0.246	S2540_MOUSE Probable mitochondrial glutathione transporter SLC25A40 OS=Mus musculus OX=10090 GN=Slc25a40 PE=1 SV=1
13	Q12482	1.02e-24	106	902	0.273	0.092	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
14	Q9BQT8	4.89e-23	98.6	299	0.237	0.241	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
15	Q9FLS8	9.57e-23	99.8	478	0.247	0.157	MAPC1_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 1 OS=Arabidopsis thaliana OX=3702 GN=APC1 PE=1 SV=1
16	P23500	1.54e-22	97.1	304	0.253	0.253	MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRS4 PE=1 SV=1
17	Q8CFJ7	1.67e-22	96.7	288	0.286	0.302	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
18	Q9VA73	3.00e-22	99.0	695	0.270	0.118	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
19	P53007	6.55e-22	95.5	311	0.247	0.241	TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2
20	Q8RWA5	1.17e-21	95.5	363	0.253	0.212	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	5.6e-56	197.8	Mitochondrial carrier protein
2	PF04051 TRAPP	50	15.0	Transport protein particle (TRAPP) component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328570	0.913	Glutaredoxin-related protein 5, mitochondrial
2	9606.ENSP00000356978	0.842	Protoporphyrinogen oxidase
3	9606.ENSP00000332369	0.840	5-aminolevulinate synthase, erythroid-specific, mitochondrial
4	9606.ENSP00000253577	0.835	ATP-binding cassette sub-family B member 7, mitochondrial
5	9606.ENSP00000372326	0.808	Ferrochelatase, mitochondrial
6	9606.ENSP00000264193	0.800	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
7	9606.ENSP00000246337	0.793	Uroporphyrinogen decarboxylase
8	9606.ENSP00000386284	0.793	Delta-aminolevulinic acid dehydratase
9	9606.ENSP00000357787	0.787	Uroporphyrinogen-III synthase
10	9606.ENSP00000265316	0.783	ATP-binding cassette sub-family B member 6, mitochondrial
11	9606.ENSP00000355637	0.779	ATP-binding cassette sub-family B member 10, mitochondrial
12	9606.ENSP00000292574	0.725	Coiled-coil domain containing 105
13	9606.ENSP00000378416	0.721	5-aminolevulinate synthase, nonspecific, mitochondrial
14	9606.ENSP00000400592	0.712	Caspase 16, apoptosis-related cysteine peptidase (putative)
15	9606.ENSP00000346067	0.685	40S ribosomal protein SA
16	9606.ENSP00000278715	0.656	Porphobilinogen deaminase
17	9606.ENSP00000417240	0.614	Ribosomal protein SA pseudogene 58
18	9606.ENSP00000355517	0.605	Kynurenine 3-monooxygenase
19	9606.ENSP00000365837	0.603	tRNA pseudouridine synthase A
20	9606.ENSP00000300107	0.597	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046943	0.996	carboxylic acid transmembrane transporter activity
GO:0015187	0.991	glycine transmembrane transporter activity
GO:0005488	0.822	binding
GO:0005515	0.437	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0071704	0.968	organic substance metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0044237	0.962	cellular metabolic process
GO:1901564	0.962	organonitrogen compound metabolic process
GO:0009058	0.956	biosynthetic process
GO:0033013	0.935	tetrapyrrole metabolic process
GO:0006779	0.934	porphyrin-containing compound biosynthetic process
GO:0042168	0.926	heme metabolic process
GO:0006783	0.920	heme biosynthetic process
GO:0051179	0.899	localization
GO:0006810	0.890	transport
GO:0071702	0.835	organic substance transport
GO:0055085	0.821	transmembrane transport
GO:0071705	0.814	nitrogen compound transport
GO:0015804	0.746	neutral amino acid transport
GO:0030218	0.618	erythrocyte differentiation
GO:1905039	0.584	carboxylic acid transmembrane transport
GO:1990542	0.319	mitochondrial transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.965	membrane
GO:0031090	0.905	organelle membrane
GO:0005740	0.803	mitochondrial envelope
GO:0031966	0.776	mitochondrial membrane
GO:0005743	0.378	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]