StarFunc result for job id Q96DX4

User Input

>input (576 residues)
MIVFGWAVFLASRSLGQGLLLTLEEHIAHFLGTGGAATTMGNSCICRDDSGTDDSVDTQQ
QQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWANDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHIHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRIRQISHIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3RJH1	0.298	0.235	6.855E-14	740	0.097	0.076	A3RJH1.pdb.gz	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
2	AFDB:Q9VNV3	0.293	0.235	4.243E-13	727	0.083	0.066	Q9VNV3.pdb.gz	DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster OX=7227 GN=Ddx1 PE=2 SV=1
3	PDB:7nscA	0.267	0.544	1.043E-10	276	0.069	0.145	7nscA.pdb.gz
4	PDB:7ccbA	0.261	0.859	4.306E-10	164	0.054	0.189	7ccbA.pdb.gz
5	PDB:7ua3A	0.205	0.031	3.799E-9	4443	0.137	0.018	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
6	PDB:7m6aA	0.221	0.032	4.893E-9	4306	0.135	0.018	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
7	PDB:7tzcA	0.226	0.032	7.337E-9	4404	0.135	0.018	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
8	PDB:7u9tA	0.202	0.030	8.541E-9	4229	0.134	0.018	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
9	PDB:7vmlA	0.232	0.035	1.157E-8	4044	0.120	0.017	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
10	PDB:3j8hA	0.224	0.038	5.561E-8	3660	0.106	0.017	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
11	PDB:7t65A	0.203	0.031	2.811E-7	4252	0.132	0.018	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
12	PDB:5t15B	0.205	0.032	3.272E-7	4170	0.130	0.018	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
13	AFDB:Q6MG92	0.232	0.228	2.272E-6	588	0.062	0.061	Q6MG92.pdb.gz	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
14	AFDB:Q61510	0.237	0.216	4.856E-6	634	0.052	0.047	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
15	AFDB:F4ILG6	0.178	0.134	3.415E-4	829	0.082	0.057	F4ILG6.pdb.gz	F4ILG6_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=PUB4 PE=1 SV=1
16	AFDB:Q582C4	0.224	0.123	3.415E-4	1339	0.087	0.037	Q582C4.pdb.gz	Q582C4_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.520 PE=3 SV=1
17	AFDB:J3KNS1	0.188	0.097	1.151E-3	1278	0.066	0.030	J3KNS1.pdb.gz	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
18	AFDB:Q38CB9	0.184	0.161	1.641E-3	680	0.052	0.044	Q38CB9.pdb.gz	Q38CB9_TRYB2 Katanin p60 ATPase-containing subunit A1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=KATNA1 PE=3 SV=1
19	AFDB:Q9SQI2	0.235	0.130	4.752E-3	1173	0.089	0.043	Q9SQI2.pdb.gz	GIGAN_ARATH Protein GIGANTEA OS=Arabidopsis thaliana OX=3702 GN=GI PE=1 SV=2
20	AFDB:Q8MQ52	0.213	0.291	5.819E-3	390	0.057	0.085	Q8MQ52.pdb.gz	Q8MQ52_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F44A2.5 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9VFC4	2.36e-22	104	1332	0.104	0.045	Q9VFC4_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Kpc1 PE=1 SV=1
2	F4IIK4	8.30e-21	99.4	1283	0.097	0.044	F4IIK4_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=RKP PE=1 SV=1
3	Q9SIZ8	8.74e-21	99.4	1280	0.097	0.044	RKP_ARATH E3 ubiquitin-protein ligase RKP OS=Arabidopsis thaliana OX=3702 GN=RKP PE=2 SV=2
4	Q5XPI4	1.64e-19	95.5	1314	0.092	0.040	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
5	I2HAA6	1.10e-12	73.9	5187	0.109	0.012	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
6	B7WN66	1.15e-12	73.9	5085	0.109	0.012	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
7	I2HAA7	1.15e-12	73.9	5071	0.109	0.012	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
8	Q94279	1.19e-12	73.9	5201	0.109	0.012	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
9	P30957	3.27e-12	72.4	4969	0.066	0.008	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
10	P21817	5.53e-12	71.6	5038	0.066	0.008	RYR1_HUMAN Ryanodine receptor 1 OS=Homo sapiens OX=9606 GN=RYR1 PE=1 SV=3
11	B0LPN4	6.23e-12	71.6	4953	0.061	0.007	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
12	Q92736	6.50e-12	71.2	4967	0.064	0.007	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
13	E9Q401	1.91e-11	69.7	4966	0.059	0.007	RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus OX=10090 GN=Ryr2 PE=1 SV=1
14	C9J266	4.80e-11	68.2	762	0.071	0.054	C9J266_HUMAN Ring finger protein 123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
15	P11716	7.34e-11	68.2	5037	0.064	0.007	RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=1 SV=1
16	E9PZQ0	8.21e-11	67.8	5035	0.062	0.007	RYR1_MOUSE Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1
17	A2AGL3	4.77e-10	65.5	4863	0.059	0.007	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
18	Q15413	6.60e-10	65.1	4870	0.061	0.007	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
19	Q24498	2.17e-09	63.2	5127	0.062	0.007	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
20	A6P4B8	3.78e-09	62.4	5076	0.062	0.007	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.025	25.7	Prokaryotic RING finger family 4
2	PF00622 SPRY	4e-16	70.6	SPRY domain
3	PF13920 zf-C3HC4_3	7.1e-05	33.9	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443176

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335808	0.822	Protein FAM192A
2	9606.ENSP00000380054	0.817	ELL-associated factor 1
3	9606.ENSP00000262103	0.795	EF-hand calcium-binding domain-containing protein 1
4	9606.ENSP00000324204	0.789	Maturin
5	9606.ENSP00000407613	0.783	S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser)
6	9606.ENSP00000332062	0.780	Sorting nexin-20
7	9606.ENSP00000222803	0.748	Peptidyl-prolyl cis-trans isomerase FKBP14
8	9606.ENSP00000219204	0.737	ADP-ribosylation factor-like protein 2-binding protein
9	9606.ENSP00000301825	0.736	Ectonucleoside triphosphate diphosphohydrolase 3
10	9606.ENSP00000397947	0.736	Pleckstrin homology domain-containing family A member 8
11	9606.ENSP00000275428	0.734	Gamma-glutamylcyclotransferase
12	9606.ENSP00000323879	0.713	E3 ubiquitin-protein ligase ZNRF2
13	9606.ENSP00000369390	0.701	Cyclin-dependent kinase 14
14	9606.ENSP00000257575	0.697	Ring finger protein, transmembrane 2
15	9606.ENSP00000378181	0.695	Bromodomain-containing protein 7
16	9606.ENSP00000373918	0.692	Glycine--tRNA ligase
17	9606.ENSP00000379506	0.648	60S ribosomal protein L14
18	9606.ENSP00000428281	0.646	Leptin receptor overlapping transcript-like 1
19	9606.ENSP00000362094	0.641	Gametocyte-specific factor 1-like
20	9606.ENSP00000268459	0.633	Protein naked cuticle homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0071704	0.868	organic substance metabolic process
GO:0044238	0.848	primary metabolic process
GO:0006807	0.775	nitrogen compound metabolic process
GO:0043412	0.760	macromolecule modification
GO:1901564	0.698	organonitrogen compound metabolic process
GO:0019538	0.676	protein metabolic process
GO:0019222	0.443	regulation of metabolic process
GO:0036211	0.436	protein modification process
GO:0048518	0.411	positive regulation of biological process
GO:0048519	0.404	negative regulation of biological process
GO:0080090	0.402	regulation of primary metabolic process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0060255	0.360	regulation of macromolecule metabolic process
GO:0044237	0.309	cellular metabolic process
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0012505	0.990	endomembrane system
GO:0016020	0.988	membrane
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0032991	0.969	protein-containing complex
GO:0005829	0.447	cytosol
GO:0031982	0.422	vesicle
GO:0071944	0.368	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]