StarFunc result for job id Q96DX7

User Input

>input (344 residues)
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY
VHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE
SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP
DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER
LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ
SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DX7	1.000	1.000	4.363E-51	344	1.000	1.000	Q96DX7.pdb.gz	TRI44_HUMAN Tripartite motif-containing protein 44 OS=Homo sapiens OX=9606 GN=TRIM44 PE=1 SV=1
2	AFDB:Q99PP9	0.159	0.107	9.917E-5	556	0.166	0.103	Q99PP9.pdb.gz	TRI16_MOUSE Tripartite motif-containing protein 16 OS=Mus musculus OX=10090 GN=Trim16 PE=1 SV=2
3	AFDB:O95361	0.179	0.116	1.276E-4	564	0.166	0.101	O95361.pdb.gz	TRI16_HUMAN Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3
4	AFDB:H0Y626	0.182	0.072	1.542E-4	953	0.169	0.061	H0Y626.pdb.gz	H0Y626_HUMAN B box-type domain-containing protein OS=Homo sapiens OX=9606 PE=4 SV=2
5	PDB:4tn3B	0.160	0.153	3.963E-3	362	0.113	0.108	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
6	AFDB:Q6P6S3	0.175	0.137	4.083E-3	448	0.142	0.109	Q6P6S3.pdb.gz	BSPRY_RAT B box and SPRY domain-containing protein OS=Rattus norvegicus OX=10116 GN=Bspry PE=1 SV=2
7	AFDB:H0UZ81	0.167	0.086	1.119E-2	719	0.113	0.054	H0UZ81.pdb.gz	FSD2_CAVPO Fibronectin type III and SPRY domain-containing protein 2 OS=Cavia porcellus OX=10141 GN=FSD2 PE=2 SV=2
8	AFDB:A1L4K1	0.193	0.100	1.852E-2	749	0.137	0.063	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
9	AFDB:Q8BZ52	0.164	0.085	6.532E-2	716	0.084	0.041	Q8BZ52.pdb.gz	FSD2_MOUSE Fibronectin type III and SPRY domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fsd2 PE=1 SV=3
10	AFDB:Q8LG76	0.116	0.099	6.532E-2	406	0.099	0.084	Q8LG76.pdb.gz	COL6_ARATH Zinc finger protein CONSTANS-LIKE 6 OS=Arabidopsis thaliana OX=3702 GN=COL6 PE=2 SV=2
11	AFDB:F8W6Z2	0.182	0.119	6.956E-2	601	0.122	0.070	F8W6Z2.pdb.gz	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
12	PDB:7z36B	0.175	0.139	1.438E-1	446	0.081	0.063	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
13	PDB:4n78F	0.202	0.388	3.063E-1	156	0.058	0.128	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:7nshBG	0.129	0.215	3.701E-1	196	0.035	0.061	7nshBG.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
15	PDB:7enag	0.160	0.278	4.198E-1	166	0.058	0.120	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:6tuyA	0.182	0.099	4.762E-1	667	0.038	0.019	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
17	PDB:2q0oD	0.165	0.494	5.401E-1	87	0.047	0.184	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
18	PDB:3ajwA	0.180	0.380	8.395E-1	134	0.049	0.127	3ajwA.pdb.gz
19	PDB:7nvrk	0.132	0.300	9.523E-1	133	0.058	0.150	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
20	PDB:3mxzA	0.074	0.215	1.080	107	0.035	0.112	3mxzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DX7	0.0	677	344	1.000	1.000	TRI44_HUMAN Tripartite motif-containing protein 44 OS=Homo sapiens OX=9606 GN=TRIM44 PE=1 SV=1
2	Q9UJV3	1.39e-05	49.3	735	0.070	0.033	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
3	Q6FIU8	2.93e-05	48.5	4880	0.096	0.007	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
4	H0Y735	3.60e-05	46.6	227	0.093	0.141	H0Y735_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=1
5	Q8II80	5.37e-05	47.8	1570	0.070	0.015	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
6	A2AAZ6	6.00e-05	46.2	260	0.093	0.123	A2AAZ6_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=8
7	Q12019	6.00e-05	47.4	4910	0.108	0.008	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
8	Q80V85	9.68e-05	46.2	475	0.105	0.076	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
9	Q9BVG3	9.94e-05	46.2	475	0.102	0.074	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
10	C9J453	1.09e-04	46.2	483	0.055	0.039	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
11	O15344	1.11e-04	46.2	667	0.055	0.028	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
12	A0A0G2JXN2	2.19e-04	45.4	759	0.058	0.026	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
13	Q7TNM2	2.23e-04	45.4	759	0.058	0.026	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
14	A0A096LP39	2.36e-04	45.1	503	0.093	0.064	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
15	Q6ZMU5	2.82e-04	45.1	477	0.058	0.042	TRI72_HUMAN Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2
16	Q86XT4	4.43e-04	44.3	487	0.078	0.055	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2
17	A0A024RCP5	4.51e-04	44.3	518	0.093	0.062	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
18	Q9HCM9	4.51e-04	44.3	518	0.093	0.062	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
19	Q1XH17	4.88e-04	44.3	477	0.058	0.042	TRI72_MOUSE Tripartite motif-containing protein 72 OS=Mus musculus OX=10090 GN=Trim72 PE=1 SV=1
20	Q923T7	5.16e-04	44.3	510	0.102	0.069	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04559 Herpes_UL17	3.5e+02	11.4	Herpesvirus UL17 protein
2	PF00643 zf-B_box	6.2e-06	37.6	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299413

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312981	0.904	U4/U6.U5 tri-snRNP-associated protein 2
2	9606.ENSP00000400223	0.859	Four-jointed box protein 1
3	9606.ENSP00000355658	0.772	E3 ubiquitin-protein ligase TRIM17
4	9606.ENSP00000397073	0.636	Tripartite motif-containing protein 10
5	9606.ENSP00000295756	0.623	T-cell receptor-associated transmembrane adapter 1
6	9606.ENSP00000365924	0.621	E3 ubiquitin-protein ligase TRIM31
7	9606.ENSP00000334657	0.615	Tripartite motif-containing protein 46
8	9606.ENSP00000263182	0.607	Gamma-butyrobetaine dioxygenase
9	9606.ENSP00000311695	0.604	Coiled-coil domain-containing protein 85B
10	9606.ENSP00000363298	0.586	B box and SPRY domain-containing protein
11	9606.ENSP00000344208	0.577	Tripartite motif-containing protein 14
12	9606.ENSP00000261597	0.560	Kinetochore protein NDC80 homolog
13	9606.ENSP00000243911	0.556	Melanocortin receptor 3
14	9606.ENSP00000384876	0.556	Tripartite motif-containing protein 66
15	9606.ENSP00000298355	0.552	E3 ubiquitin-protein ligase TRIM9
16	9606.ENSP00000408292	0.551	E3 ubiquitin-protein ligase TRIM32
17	9606.ENSP00000348299	0.533	E3 ubiquitin-protein ligase TRIM13
18	9606.ENSP00000424381	0.525	Lipase maturation factor 2
19	9606.ENSP00000323889	0.524	E3 ubiquitin/ISG15 ligase TRIM25
20	9606.ENSP00000343129	0.519	Tripartite motif-containing protein 29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:1902531	0.981	regulation of intracellular signal transduction
GO:0009967	0.980	positive regulation of signal transduction
GO:0031326	0.977	regulation of cellular biosynthetic process
GO:0010556	0.976	regulation of macromolecule biosynthetic process
GO:0060759	0.971	regulation of response to cytokine stimulus
GO:1903506	0.968	regulation of nucleic acid-templated transcription
GO:0002831	0.959	regulation of response to biotic stimulus
GO:0031347	0.959	regulation of defense response
GO:0006355	0.956	regulation of DNA-templated transcription
GO:0048519	0.952	negative regulation of biological process
GO:0032101	0.948	regulation of response to external stimulus
GO:0031399	0.941	regulation of protein modification process
GO:0050688	0.936	regulation of defense response to virus
GO:0050691	0.931	regulation of defense response to virus by host
GO:0051248	0.928	negative regulation of protein metabolic process
GO:0002230	0.917	positive regulation of defense response to virus by host
GO:0031647	0.910	regulation of protein stability
GO:1901222	0.902	regulation of NIK/NF-kappaB signaling
GO:0001959	0.897	regulation of cytokine-mediated signaling pathway
GO:1903320	0.886	regulation of protein modification by small protein conjugation or removal
GO:0060760	0.864	positive regulation of response to cytokine stimulus
GO:0031400	0.864	negative regulation of protein modification process
GO:1903321	0.836	negative regulation of protein modification by small protein conjugation or removal
GO:0031325	0.817	positive regulation of cellular metabolic process
GO:0031396	0.811	regulation of protein ubiquitination
GO:1902533	0.760	positive regulation of intracellular signal transduction
GO:0031397	0.709	negative regulation of protein ubiquitination
GO:0010604	0.532	positive regulation of macromolecule metabolic process
GO:0051173	0.528	positive regulation of nitrogen compound metabolic process
GO:0045935	0.516	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.448	positive regulation of RNA metabolic process
GO:0050821	0.445	protein stabilization
GO:0031328	0.426	positive regulation of cellular biosynthetic process
GO:0001961	0.422	positive regulation of cytokine-mediated signaling pathway
GO:0045893	0.418	positive regulation of DNA-templated transcription
GO:1901224	0.407	positive regulation of NIK/NF-kappaB signaling
GO:0009987	0.395	cellular process
GO:0071704	0.376	organic substance metabolic process
GO:0050896	0.364	response to stimulus
GO:0006807	0.321	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.993	intracellular organelle lumen
GO:0005829	0.992	cytosol
GO:0005634	0.986	nucleus
GO:0031981	0.981	nuclear lumen
GO:0005654	0.873	nucleoplasm
GO:0043232	0.366	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]