StarFunc result for job id Q96DX8

User Input

>input (246 residues)
MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQR
SWASAQVQILCHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQ
HILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPH
LKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDPLNICVFILLLVFIVV
KCFTSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DX8	1.000	1.000	8.832E-50	246	1.000	1.000	Q96DX8.pdb.gz	RTP4_HUMAN Receptor-transporting protein 4 OS=Homo sapiens OX=9606 GN=RTP4 PE=1 SV=3
2	AFDB:Q9BQQ7	0.646	0.684	5.071E-26	232	0.382	0.405	Q9BQQ7.pdb.gz	RTP3_HUMAN Receptor-transporting protein 3 OS=Homo sapiens OX=9606 GN=RTP3 PE=1 SV=1
3	AFDB:Q9ER80	0.597	0.590	3.016E-22	249	0.415	0.410	Q9ER80.pdb.gz	RTP4_MOUSE Receptor-transporting protein 4 OS=Mus musculus OX=10090 GN=Rtp4 PE=1 SV=1
4	AFDB:P59025	0.597	0.560	9.701E-18	263	0.264	0.247	P59025.pdb.gz	RTP1_HUMAN Receptor-transporting protein 1 OS=Homo sapiens OX=9606 GN=RTP1 PE=2 SV=2
5	AFDB:Q80ZI2	0.591	0.648	1.170E-17	223	0.215	0.238	Q80ZI2.pdb.gz	RTP2_MOUSE Receptor-transporting protein 2 OS=Mus musculus OX=10090 GN=Rtp2 PE=1 SV=1
6	AFDB:Q5QGT7	0.562	0.613	1.412E-17	225	0.215	0.236	Q5QGT7.pdb.gz	RTP2_HUMAN Receptor-transporting protein 2 OS=Homo sapiens OX=9606 GN=RTP2 PE=1 SV=1
7	AFDB:Q14D33	0.453	0.206	6.141E-14	572	0.252	0.108	Q14D33.pdb.gz	RTP5_HUMAN Receptor-transporting protein 5 OS=Homo sapiens OX=9606 GN=RTP5 PE=1 SV=2
8	AFDB:Q91ZD6	0.096	0.090	7.917E-2	262	0.110	0.103	Q91ZD6.pdb.gz	EAF2_MOUSE ELL-associated factor 2 OS=Mus musculus OX=10090 GN=Eaf2 PE=1 SV=1
9	AFDB:Q96CJ1	0.115	0.110	1.785E-1	260	0.118	0.112	Q96CJ1.pdb.gz	EAF2_HUMAN ELL-associated factor 2 OS=Homo sapiens OX=9606 GN=EAF2 PE=1 SV=1
10	PDB:6h68M	0.073	0.051	1.952E-1	396	0.045	0.028	6h68M.pdb.gz	Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.
11	PDB:7pmkR	0.106	0.062	2.078E-1	552	0.069	0.031	7pmkR.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
12	PDB:5yzgY	0.164	0.189	2.507E-1	204	0.065	0.078	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:7vbaN	0.108	0.165	3.024E-1	151	0.057	0.093	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
14	PDB:4xb6E	0.115	0.162	3.648E-1	149	0.033	0.054	4xb6E.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
15	PDB:7ob9M	0.081	0.056	3.648E-1	388	0.061	0.039	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
16	PDB:4ifdI	0.102	0.109	4.987E-1	230	0.037	0.039	4ifdI.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
17	AFDB:Q8VC56	0.115	0.067	5.166E-1	488	0.138	0.070	Q8VC56.pdb.gz	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
18	PDB:5klqA	0.131	0.105	6.016E-1	324	0.049	0.037	5klqA.pdb.gz	Structure of a pathogen effector reveals the enzymatic mechanism of a novel acetyltransferase family.
19	PDB:6wgg5	0.093	0.042	7.258E-1	599	0.041	0.017	6wgg5.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
20	PDB:1iznA	0.139	0.128	7.726E-1	275	0.061	0.055	1iznA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DX8	0.0	514	246	1.000	1.000	RTP4_HUMAN Receptor-transporting protein 4 OS=Homo sapiens OX=9606 GN=RTP4 PE=1 SV=3
2	Q9ER80	3.18e-55	179	249	0.366	0.361	RTP4_MOUSE Receptor-transporting protein 4 OS=Mus musculus OX=10090 GN=Rtp4 PE=1 SV=1
3	Q9BQQ7	6.63e-50	165	232	0.341	0.362	RTP3_HUMAN Receptor-transporting protein 3 OS=Homo sapiens OX=9606 GN=RTP3 PE=1 SV=1
4	Q5QGT7	3.50e-21	90.5	225	0.289	0.316	RTP2_HUMAN Receptor-transporting protein 2 OS=Homo sapiens OX=9606 GN=RTP2 PE=1 SV=1
5	Q8C8C1	1.02e-19	87.4	263	0.228	0.213	RTP1_MOUSE Receptor-transporting protein 1 OS=Mus musculus OX=10090 GN=Rtp1 PE=1 SV=1
6	P59025	3.18e-19	85.9	263	0.228	0.213	RTP1_HUMAN Receptor-transporting protein 1 OS=Homo sapiens OX=9606 GN=RTP1 PE=2 SV=2
7	Q80ZI2	1.05e-18	84.0	223	0.232	0.256	RTP2_MOUSE Receptor-transporting protein 2 OS=Mus musculus OX=10090 GN=Rtp2 PE=1 SV=1
8	Q14D33	4.08e-18	85.1	572	0.215	0.093	RTP5_HUMAN Receptor-transporting protein 5 OS=Homo sapiens OX=9606 GN=RTP5 PE=1 SV=2
9	C3VD30	0.13	35.4	291	0.089	0.076	ZAR1L_MOUSE Protein ZAR1-like OS=Mus musculus OX=10090 GN=Zar1l PE=1 SV=1
10	P19516	0.24	34.7	300	0.061	0.050	COX11_YEAST Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX11 PE=1 SV=2
11	A0A1L8HBI7	0.68	33.1	281	0.098	0.085	ZA1LS_XENLA Protein ZAR1-like 1.S OS=Xenopus laevis OX=8355 GN=zar1l.S PE=1 SV=1
12	Q8VZK9	1.7	32.3	729	0.053	0.018	CSLE1_ARATH Cellulose synthase-like protein E1 OS=Arabidopsis thaliana OX=3702 GN=CSLE1 PE=2 SV=1
13	P69506	2.9	31.2	220	0.089	0.100	YTFE_ECOLI Iron-sulfur cluster repair protein YtfE OS=Escherichia coli (strain K12) OX=83333 GN=ytfE PE=1 SV=1
14	Q9VTX2	3.2	31.6	663	0.069	0.026	Q9VTX2_DROME RE32936p OS=Drosophila melanogaster OX=7227 GN=Smyd4-2 PE=2 SV=1
15	Q5GH66	5.7	30.8	676	0.130	0.047	XKR5_MOUSE XK-related protein 5 OS=Mus musculus OX=10090 GN=Xkr5 PE=2 SV=1
16	Q5B186	6.1	30.4	694	0.085	0.030	Q5B186_EMENI polynucleotide adenylyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05694 PE=3 SV=1
17	O15230	7.5	30.4	3695	0.118	0.008	LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens OX=9606 GN=LAMA5 PE=1 SV=8
18	A0A0A0MSA0	8.6	30.4	3277	0.077	0.006	A0A0A0MSA0_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=1
19	Q16787	8.6	30.4	3333	0.077	0.006	LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens OX=9606 GN=LAMA3 PE=1 SV=3
20	Q38FX4	9.7	30.0	4479	0.061	0.003	Q38FX4_TRYB2 Fibronectin type-III domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0650 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13695 zf-3CxxC	3e-26	103.1	Zinc-binding domain
2	PF17180 zf-3CxxC_2	1.1e+02	14.9	Zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360883	0.897	Interferon-induced protein with tetratricopeptide repeats 3
2	9606.ENSP00000371471	0.886	Radical S-adenosyl methionine domain-containing protein 2
3	9606.ENSP00000368699	0.879	Ubiquitin-like protein ISG15
4	9606.ENSP00000359783	0.876	Interferon-induced protein 44
5	9606.ENSP00000359787	0.866	Interferon-induced protein 44-like
6	9606.ENSP00000342278	0.863	2'-5'-oligoadenylate synthase 2
7	9606.ENSP00000263642	0.862	Interferon-induced helicase C domain-containing protein 1
8	9606.ENSP00000326247	0.859	Sterile alpha motif domain-containing protein 9-like
9	9606.ENSP00000215794	0.852	Ubl carboxyl-terminal hydrolase 18
10	9606.ENSP00000360869	0.847	Interferon-induced protein with tetratricopeptide repeats 1
11	9606.ENSP00000388001	0.845	2'-5'-oligoadenylate synthase 1
12	9606.ENSP00000377344	0.842	Probable ATP-dependent RNA helicase DDX60
13	9606.ENSP00000333266	0.822	Ubiquitin-like modifier-activating enzyme 7
14	9606.ENSP00000381601	0.821	Interferon-induced GTP-binding protein Mx1
15	9606.ENSP00000251642	0.820	Probable ATP-dependent RNA helicase DHX58
16	9606.ENSP00000257570	0.813	2'-5'-oligoadenylate synthase-like protein
17	9606.ENSP00000360215	0.807	Z-DNA-binding protein 1
18	9606.ENSP00000333657	0.794	Interferon-induced GTP-binding protein Mx2
19	9606.ENSP00000380697	0.792	Interferon regulatory factor 7
20	9606.ENSP00000264346	0.785	Probable E3 ubiquitin-protein ligase HERC6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.417	nucleic acid binding
GO:0003723	0.332	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0009615	0.994	response to virus
GO:0140546	0.987	defense response to symbiont
GO:0051607	0.982	defense response to virus
GO:0009593	0.977	detection of chemical stimulus
GO:0050913	0.977	sensory perception of bitter taste
GO:0006612	0.977	protein targeting to membrane
GO:0050907	0.966	detection of chemical stimulus involved in sensory perception
GO:0050912	0.884	detection of chemical stimulus involved in sensory perception of taste

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.427	intracellular organelle
GO:0005829	0.407	cytosol
GO:0043231	0.368	intracellular membrane-bounded organelle
GO:0005634	0.358	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]