StarFunc result for job id Q96DY7

User Input

>input (904 residues)
MDRYLLLVIWGEGKFPSAASREAEHGPEVSSGEGTENQPDFTAANVYHLLKRSISASINP
EDSTFPACSVGGIPGSKKWFFAVQAIYGFYQFCSSDWQEIHFDTEKDKIEDVLQTNIEEC
LGAVECFEEEDSNSRESLSLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKL
KDYLPTVGALKHLREWYSAKITIAGNHCEINCQKIAEYLSANVVSLEDLRNVIDSKELWR
GKIQIWERKFGFEISFPEFCLKGVTLKNFSTSNLNTDFLAKKIIPSKDKNILPKVFHYYG
PALEFVQMIKLSDLPSCYMSDIEFELGLTNSTKQNSVLLLEQISSLCSKVGALFVLPCTI
SNILIPPPNQLSSRKWKEYIAKKPKTISVPDVEVKGECSSYYLLLQGNGNRRCKATLIHS
ANQINGSFALNLIHGKMKTKTEEAKLSFPFDLLSLPHFSGEQIVQREKQLANVQVLALEE
CLKRRKLAKQPETVSVAELKSLLVLTRKHFLDYFDAVIPKMILRKMDKIKTFNILNDFSP
VEPNSSSLMETNPLEWPERHVLQNLETFEKTKQKMRTGSLPHSSEQLLGHKEGPRDSITL
LDAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIE
YCLDDRKALERDGGFSELQSRLIRYETQTTCTRESFPVPTVLSPLPSPVVSSDPGSVPDG
EVLQNELRTEVSRLKRRSKDLNCLYPRKRLVKSESSESLLSQTTGNSNHYHHHVTSRKPQ
TERSLPVTCPLVPIPSCETPKLATKTSSGQKSMHESKTSRQIKESRSQKHTRILKEVVTE
TLKKHSITETHECFTACSQRLFEISKFYLKDLKTSRGLFEEMKKTANNNAVQVIDWVLEK
TSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BJS8	0.620	0.626	0.000	894	0.770	0.779	Q8BJS8.pdb.gz	MTBP_MOUSE Mdm2-binding protein OS=Mus musculus OX=10090 GN=Mtbp PE=1 SV=1
2	AFDB:Q96DY7	1.000	1.000	0.000	904	1.000	1.000	Q96DY7.pdb.gz	MTBP_HUMAN Mdm2-binding protein OS=Homo sapiens OX=9606 GN=MTBP PE=1 SV=1
3	AFDB:Q7Z2Z1	0.149	0.083	7.711E-10	1910	0.115	0.054	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
4	PDB:5y58A	0.190	0.273	6.916E-9	548	0.072	0.119	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
5	PDB:5y58B	0.140	0.201	3.895E-8	568	0.061	0.097	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
6	PDB:1jeqA	0.201	0.294	2.579E-7	548	0.086	0.142	1jeqA.pdb.gz
7	PDB:6zheC	0.127	0.151	5.494E-7	705	0.087	0.112	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
8	PDB:7nfcC	0.131	0.200	6.819E-7	477	0.066	0.126	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
9	PDB:7k0yC	0.148	0.187	1.903E-6	655	0.069	0.095	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
10	PDB:6sn1A	0.124	0.179	9.813E-5	517	0.065	0.114	6sn1A.pdb.gz
11	PDB:7egb3	0.147	0.406	4.453E-4	263	0.027	0.091	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:1m2vA	0.126	0.153	5.061E-3	705	0.044	0.057	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
13	PDB:7ena3	0.139	0.343	1.201E-2	295	0.024	0.075	7ena3.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	AFDB:M9PC73	0.053	0.043	1.294E-2	1158	0.069	0.054	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
15	AFDB:Q7KU30	0.045	0.041	1.522E-2	1017	0.041	0.036	Q7KU30.pdb.gz	Q7KU30_DROME Early gene at 23, isoform C OS=Drosophila melanogaster OX=7227 GN=E23 PE=2 SV=1
16	AFDB:Q84M91	0.046	0.081	2.757E-2	444	0.067	0.137	Q84M91.pdb.gz	TANB_ARATH Probable microtubule-binding protein TANGLED OS=Arabidopsis thaliana OX=3702 GN=TAN PE=1 SV=1
17	AFDB:D3ZGN0	0.075	0.056	3.612E-2	1309	0.077	0.053	D3ZGN0.pdb.gz	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
18	AFDB:Q63ZY3	0.052	0.055	4.994E-2	851	0.107	0.114	Q63ZY3.pdb.gz	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1
19	AFDB:Q7SZZ4	0.087	0.069	4.994E-2	1229	0.125	0.092	Q7SZZ4.pdb.gz	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
20	AFDB:D4A6E4	0.035	0.038	6.198E-2	762	0.080	0.094	D4A6E4.pdb.gz	D4A6E4_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BJS8	0.0	1415	894	0.771	0.780	MTBP_MOUSE Mdm2-binding protein OS=Mus musculus OX=10090 GN=Mtbp PE=1 SV=1
2	Q96DY7	0.0	1860	904	1.000	1.000	MTBP_HUMAN Mdm2-binding protein OS=Homo sapiens OX=9606 GN=MTBP PE=1 SV=1
3	Q9FKN7	3.6	33.9	1613	0.029	0.016	DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana OX=3702 GN=DAR4 PE=1 SV=2
4	E1BF23	4.3	33.5	1495	0.023	0.014	E1BF23_BOVIN Myomesin 2 OS=Bos taurus OX=9913 GN=MYOM2 PE=4 SV=3
5	P08518	6.9	33.1	1224	0.033	0.025	RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB2 PE=1 SV=2
6	Q39032	7.5	32.7	561	0.021	0.034	PLCD1_ARATH Phosphoinositide phospholipase C 1 OS=Arabidopsis thaliana OX=3702 GN=PLC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14920 MTBP_C	3.1e-122	418.8	MDM2-binding
2	PF14919 MTBP_mid	8.5e-159	539.6	MDM2-binding
3	PF14918 MTBP_N	2.5e-116	399.1	MDM2-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.988	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000268138	0.985	Treslin
3	9606.ENSP00000405726	0.700	Cell division control protein 45 homolog
4	9606.ENSP00000336701	0.687	DNA repair protein RAD51 homolog 3
5	9606.ENSP00000260810	0.683	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000363255	0.671	Regulator of G-protein signaling 3
7	9606.ENSP00000261593	0.653	E3 ubiquitin-protein ligase RNF138
8	9606.ENSP00000295488	0.651	Helicase POLQ-like
9	9606.ENSP00000479207	0.648	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5
10	9606.ENSP00000387006	0.646	Pre-mRNA-splicing factor CWC22 homolog
11	9606.ENSP00000276201	0.642	Regulator of nonsense transcripts 3B
12	9606.ENSP00000235310	0.614	Mitotic spindle assembly checkpoint protein MAD2B
13	9606.ENSP00000356243	0.602	Ubiquitin-conjugating enzyme E2 T
14	9606.ENSP00000370938	0.587	Cyclin-dependent kinase 8
15	9606.ENSP00000377492	0.585	Hyaluronan mediated motility receptor
16	9606.ENSP00000381378	0.581	Fanconi anemia group B protein
17	9606.ENSP00000310842	0.575	Fanconi anemia group I protein
18	9606.ENSP00000360316	0.570	Delta(24)-sterol reductase
19	9606.ENSP00000252699	0.563	Alpha-actinin-4
20	9606.ENSP00000306548	0.562	Mitochondrial ribosomal protein L13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0034502	0.878	protein localization to chromosome
GO:0050789	0.875	regulation of biological process
GO:0050794	0.817	regulation of cellular process
GO:1903083	0.686	protein localization to condensed chromosome
GO:0071459	0.670	protein localization to chromosome, centromeric region
GO:0034501	0.581	protein localization to kinetochore
GO:0048518	0.465	positive regulation of biological process
GO:0048522	0.417	positive regulation of cellular process
GO:0048519	0.361	negative regulation of biological process
GO:0048523	0.331	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000776	0.998	kinetochore
GO:0005654	0.970	nucleoplasm
GO:0005737	0.804	cytoplasm
GO:0000785	0.664	chromatin
GO:0032991	0.608	protein-containing complex
GO:0005829	0.499	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]