StarFunc result for job id Q96DZ1

User Input

>input (483 residues)
MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVL
YKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESY
WTYEVCHGKHIRQYHEEKETGQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKN
IEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHEILSVAEVTTCEYEVVILT
PLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTK
EERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYEFCYGK
HVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLS
LPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96DZ1	1.000	1.000	1.123E-97	483	1.000	1.000	Q96DZ1.pdb.gz	ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1 PE=1 SV=1
2	AFDB:F1SQJ5	0.351	0.371	2.207E-80	456	0.915	0.969	F1SQJ5.pdb.gz
3	AFDB:Q9VKC7	0.391	0.366	2.067E-43	525	0.306	0.282	Q9VKC7.pdb.gz	Q9VKC7_DROME FI04402p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6766 PE=1 SV=1
4	AFDB:Q8K2C7	0.285	0.212	1.526E-17	672	0.164	0.118	Q8K2C7.pdb.gz	OS9_MOUSE Protein OS-9 OS=Mus musculus OX=10090 GN=Os9 PE=1 SV=2
5	AFDB:Q13438	0.286	0.219	4.625E-17	667	0.166	0.120	Q13438.pdb.gz	OS9_HUMAN Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 PE=1 SV=1
6	AFDB:Q8GWH3	0.303	0.471	1.751E-16	282	0.141	0.241	Q8GWH3.pdb.gz	OS9_ARATH Protein OS-9 homolog OS=Arabidopsis thaliana OX=3702 GN=OS9 PE=1 SV=1
7	AFDB:Q383K9	0.252	0.431	3.798E-14	262	0.099	0.183	Q383K9.pdb.gz	Q383K9_TRYB2 MRH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2470 PE=4 SV=1
8	AFDB:Q99220	0.290	0.264	4.349E-11	542	0.116	0.103	Q99220.pdb.gz	OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOS9 PE=1 SV=1
9	AFDB:Q6S5C2	0.197	0.298	7.150E-9	307	0.079	0.124	Q6S5C2.pdb.gz	GNPTG_MOUSE N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Mus musculus OX=10090 GN=Gnptg PE=1 SV=1
10	AFDB:Q9UJJ9	0.194	0.290	1.736E-8	305	0.087	0.138	Q9UJJ9.pdb.gz	GNPTG_HUMAN N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Homo sapiens OX=9606 GN=GNPTG PE=1 SV=1
11	PDB:7vciR	0.131	0.073	4.073E-3	1082	0.091	0.041	7vciR.pdb.gz
12	PDB:7fikj	0.135	0.083	1.458E-2	1028	0.085	0.040	7fikj.pdb.gz
13	PDB:7uy5I	0.084	0.078	2.334E-1	528	0.062	0.057	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
14	PDB:6urgA	0.096	0.054	4.065E-1	1202	0.085	0.034	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
15	PDB:7emfN	0.082	0.044	4.297E-1	1017	0.072	0.034	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:3o61D	0.061	0.120	4.542E-1	190	0.048	0.121	3o61D.pdb.gz	Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
17	PDB:7lbmr	0.067	0.041	5.074E-1	1034	0.079	0.037	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
18	PDB:3g65C	0.062	0.098	5.364E-1	258	0.079	0.147	3g65C.pdb.gz
19	PDB:7r5jK0	0.116	0.065	5.670E-1	1086	0.087	0.039	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:6o9lT	0.058	0.097	6.696E-1	237	0.058	0.118	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96DZ1	0.0	1003	483	1.000	1.000	ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1 PE=1 SV=1
2	Q9VKC7	2.44e-80	261	525	0.333	0.307	Q9VKC7_DROME FI04402p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6766 PE=1 SV=1
3	Q8MQY6	1.72e-58	200	418	0.257	0.297	Q8MQY6_DROME RE67845p OS=Drosophila melanogaster OX=7227 GN=CG6766 PE=2 SV=1
4	Q8GWH3	1.48e-19	90.9	282	0.137	0.234	OS9_ARATH Protein OS-9 homolog OS=Arabidopsis thaliana OX=3702 GN=OS9 PE=1 SV=1
5	Q13438	2.61e-19	93.2	667	0.135	0.097	OS9_HUMAN Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 PE=1 SV=1
6	Q8K2C7	5.86e-18	89.4	672	0.137	0.098	OS9_MOUSE Protein OS-9 OS=Mus musculus OX=10090 GN=Os9 PE=1 SV=2
7	Q5RKH6	3.44e-17	86.7	666	0.137	0.099	OS9_RAT Protein OS-9 OS=Rattus norvegicus OX=10116 GN=Os9 PE=1 SV=1
8	Q38E25	1.69e-08	57.4	225	0.085	0.182	Q38E25_TRYB2 Protein OS9-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1300 PE=4 SV=1
9	Q383K9	2.26e-08	57.4	262	0.066	0.122	Q383K9_TRYB2 MRH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2470 PE=4 SV=1
10	Q99220	9.68e-06	50.4	542	0.079	0.070	OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOS9 PE=1 SV=1
11	Q9UJJ9	3.19e-04	45.1	305	0.072	0.115	GNPTG_HUMAN N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Homo sapiens OX=9606 GN=GNPTG PE=1 SV=1
12	B0BNH1	8.27e-04	43.9	306	0.068	0.108	B0BNH1_RAT N-acetylglucosamine-1-phosphate transferase subunit gamma OS=Rattus norvegicus OX=10116 GN=Gnptg PE=4 SV=1
13	Q4G066	8.32e-04	43.9	305	0.068	0.108	Q4G066_RAT Gnptg protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Gnptg PE=2 SV=1
14	A0A8I5Y9M2	0.001	43.1	305	0.068	0.108	A0A8I5Y9M2_RAT N-acetylglucosamine-1-phosphate transferase subunit gamma OS=Rattus norvegicus OX=10116 GN=Gnptg PE=1 SV=1
15	Q6S5C2	0.002	43.1	307	0.070	0.111	GNPTG_MOUSE N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Mus musculus OX=10090 GN=Gnptg PE=1 SV=1
16	Q04924	0.038	38.9	702	0.097	0.067	GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTB1 PE=1 SV=1
17	Q9W482	1.4	32.7	157	0.027	0.083	Q9W482_DROME Lin-52, isoform A OS=Drosophila melanogaster OX=7227 GN=lin-52 PE=1 SV=1
18	G5EBQ8	1.5	34.3	1668	0.037	0.011	CHS2_CAEEL Chitin synthase chs-2 OS=Caenorhabditis elegans OX=6239 GN=chs-2 PE=1 SV=1
19	O74802	2.1	33.1	429	0.033	0.037	HIBCH_SCHPO Small ribosomal subunit protein mS47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snr1 PE=1 SV=1
20	Q802Z2	5.5	32.0	529	0.041	0.038	Q802Z2_DANRE Glucosidase 2 subunit beta OS=Danio rerio OX=7955 GN=zgc:55653 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07915 PRKCSH	1.3e-40	149.6	Glucosidase II beta subunit-like protein
2	PF13015 PRKCSH_1	3.5e-06	38.3	Glucosidase II beta subunit-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000185150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337053	0.999	Protein sel-1 homolog 1
2	9606.ENSP00000366395	0.997	E3 ubiquitin-protein ligase synoviolin
3	9606.ENSP00000158771	0.979	Derlin-2
4	9606.ENSP00000351777	0.976	Transitional endoplasmic reticulum ATPase
5	9606.ENSP00000318165	0.967	Protein OS-9
6	9606.ENSP00000384744	0.952	Derlin-3
7	9606.ENSP00000259512	0.951	Derlin-1
8	9606.ENSP00000247461	0.937	Calnexin
9	9606.ENSP00000299767	0.933	Endoplasmin
10	9606.ENSP00000480150	0.919	Hypoxia up-regulated protein 1
11	9606.ENSP00000313756	0.914	annotation not available
12	9606.ENSP00000324173	0.902	78 kDa glucose-regulated protein
13	9606.ENSP00000318147	0.901	ER degradation-enhancing alpha-mannosidase-like protein 3
14	9606.ENSP00000416066	0.885	Alpha-1-antitrypsin
15	9606.ENSP00000300289	0.879	Protein disulfide-isomerase A3
16	9606.ENSP00000256497	0.873	ER degradation-enhancing alpha-mannosidase-like protein 1
17	9606.ENSP00000327801	0.872	Protein disulfide-isomerase
18	9606.ENSP00000259253	0.850	UDP-glucose:glycoprotein glucosyltransferase 1
19	9606.ENSP00000360645	0.842	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
20	9606.ENSP00000261942	0.833	FAS-associated factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	1.000	unfolded protein binding
GO:0003824	0.785	catalytic activity
GO:0016740	0.430	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.995	metabolic process
GO:0030433	0.992	ubiquitin-dependent ERAD pathway
GO:0048523	0.977	negative regulation of cellular process
GO:0032386	0.971	regulation of intracellular transport
GO:0032387	0.961	negative regulation of intracellular transport
GO:0051224	0.960	negative regulation of protein transport
GO:0033157	0.933	regulation of intracellular protein transport
GO:0090317	0.913	negative regulation of intracellular protein transport
GO:0070861	0.381	regulation of protein exit from endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0070013	0.997	intracellular organelle lumen
GO:0005788	0.980	endoplasmic reticulum lumen
GO:0016020	0.959	membrane
GO:0031090	0.697	organelle membrane
GO:0044322	0.676	endoplasmic reticulum quality control compartment
GO:0005634	0.378	nucleus
GO:0005576	0.334	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.430	Transferases.

[back to server]