StarFunc result for job id Q96DZ5

User Input

>input (547 residues)
MTKTDPAPMAPPPRGEEEEEEEEDEPVPEAPSPTQERRQKPVVHPSAPAPLPKDYAFTFF
DPNDPACQEILFDPQTTIPELFAIVRQWVPQVQHKIDVIGNEILRRGCHVNDRDGLTDMT
LLHYACKAGAHGVGDPAAAVRLSQQLLALGADVTLRSRWTNMNALHYAAYFDVPDLVRVL
LKGARPRVVNSTCSDFNHGSALHIAASSLCLGAAKCLLEHGANPALRNRKGQVPAEVVPD
PMDMSLDKAEAALVAKELRTLLEEAVPLSCALPKVTLPNYDNVPGNLMLSALGLRLGDRV
LLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKI
SKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGD
QVLVAGQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPAS
RIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWM
LRAEMQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9EHT4	0.614	0.614	3.091E-86	547	0.985	0.985	B9EHT4.pdb.gz	CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus OX=10090 GN=Clip3 PE=1 SV=1
2	AFDB:Q8N3C7	0.448	0.351	3.239E-56	705	0.539	0.418	Q8N3C7.pdb.gz	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
3	AFDB:Q9Z0H8	0.156	0.084	2.548E-19	1047	0.183	0.096	Q9Z0H8.pdb.gz	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
4	AFDB:Q9JK25	0.149	0.072	1.156E-18	1320	0.177	0.073	Q9JK25.pdb.gz	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
5	AFDB:Q922J3	0.139	0.057	1.646E-18	1391	0.186	0.073	Q922J3.pdb.gz	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
6	AFDB:E7F2X0	0.147	0.054	8.261E-18	1569	0.176	0.061	E7F2X0.pdb.gz	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
7	AFDB:Q9VJE5	0.136	0.045	8.688E-18	1690	0.174	0.056	Q9VJE5.pdb.gz	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
8	AFDB:P30622	0.155	0.063	1.011E-17	1438	0.172	0.065	P30622.pdb.gz	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
9	AFDB:A0A286YA27	0.137	0.063	7.460E-9	1250	0.104	0.046	A0A286YA27.pdb.gz
10	AFDB:F8W5E2	0.123	0.075	8.678E-9	912	0.112	0.067	F8W5E2.pdb.gz	F8W5E2_DANRE Ubiquitin carboxyl-terminal hydrolase CYLD OS=Danio rerio OX=7955 GN=cylda PE=4 SV=1
11	PDB:2dvwA	0.241	0.524	2.261E-7	229	0.079	0.188	2dvwA.pdb.gz
12	PDB:8cs9A	0.256	0.180	3.937E-7	796	0.091	0.063	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6jd6B	0.248	0.646	2.813E-6	192	0.069	0.198	6jd6B.pdb.gz
14	PDB:6v9hC	0.190	0.349	1.817E-5	270	0.088	0.178	6v9hC.pdb.gz
15	PDB:1wg0A	0.224	0.453	2.338E-5	243	0.088	0.198	1wg0A.pdb.gz
16	PDB:4oauC	0.273	0.219	2.586E-5	692	0.082	0.065	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:5vkqA	0.244	0.098	5.794E-5	1499	0.071	0.026	5vkqA.pdb.gz
18	PDB:6v9xA	0.245	0.235	6.093E-5	571	0.097	0.093	6v9xA.pdb.gz
19	PDB:6pqpA	0.227	0.203	7.088E-5	615	0.068	0.060	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:3ehqA	0.194	0.551	1.061E-4	182	0.049	0.148	3ehqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9EHT4	0.0	1117	547	0.985	0.985	CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus OX=10090 GN=Clip3 PE=1 SV=1
2	Q96DZ5	0.0	1130	547	1.000	1.000	CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens OX=9606 GN=CLIP3 PE=1 SV=3
3	Q8N3C7	1.48e-174	511	705	0.437	0.339	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
4	B5MCH3	3.68e-127	385	571	0.336	0.322	B5MCH3_HUMAN CAP-Gly domain containing linker protein family member 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
5	E7EW06	1.41e-98	299	214	0.239	0.612	E7EW06_HUMAN CAP-Gly domain containing linker protein family member 4 (Fragment) OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
6	E7F2X0	4.88e-47	179	1569	0.176	0.061	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
7	Q922J3	2.74e-46	177	1391	0.176	0.069	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
8	P30622	8.12e-46	175	1438	0.176	0.067	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
9	Q9JK25	8.79e-46	175	1320	0.174	0.072	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
10	Q9Z0H8	2.98e-44	170	1047	0.176	0.092	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
11	O55156	5.01e-44	169	1046	0.176	0.092	CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus OX=10116 GN=Clip2 PE=1 SV=1
12	Q9UDT6	6.09e-44	169	1046	0.177	0.093	CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1
13	Q9VJE5	1.20e-38	154	1690	0.165	0.053	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
14	Q5VT06	1.07e-17	89.7	3117	0.086	0.015	CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1
15	E9Q309	9.39e-17	86.7	3095	0.069	0.012	CE350_MOUSE Centrosome-associated protein 350 OS=Mus musculus OX=10090 GN=Cep350 PE=1 SV=1
16	A4UZI0	9.16e-16	83.6	1899	0.073	0.021	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
17	A0A0B4KG24	9.75e-16	83.2	1908	0.062	0.018	A0A0B4KG24_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
18	A0A0B4LGK5	9.75e-16	83.2	1913	0.073	0.021	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
19	A1ZA18	1.00e-15	83.2	1921	0.073	0.021	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A0A0B4KFR5	1.03e-15	83.2	1957	0.062	0.017	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0017	29.9	Ankyrin repeat
2	PF12796 Ank_2	7.2e-08	44.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.005	28.1	Ankyrin repeat
4	PF13637 Ank_4	0.00018	33.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.00029	32.3	Ankyrin repeats (many copies)
6	PF01302 CAP_GLY	5.3e-47	168.9	CAP-Gly domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392025	0.916	Ubiquitin carboxyl-terminal hydrolase CYLD
2	9606.ENSP00000272317	0.913	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000304697	0.913	Polyubiquitin-B
4	9606.ENSP00000441543	0.913	Polyubiquitin-C
5	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000290246	0.835	Engulfment and cell motility protein 2
7	9606.ENSP00000259808	0.740	Receptor-interacting serine/threonine-protein kinase 1
8	9606.ENSP00000466989	0.738	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
9	9606.ENSP00000301175	0.736	Hydroxyproline dehydrogenase
10	9606.ENSP00000412763	0.736	MAM and LDL-receptor class A domain-containing protein 1
11	9606.ENSP00000221891	0.712	Amyloid-like protein 1
12	9606.ENSP00000162749	0.708	Tumor necrosis factor receptor superfamily member 1A
13	9606.ENSP00000265881	0.708	Oligoribonuclease, mitochondrial
14	9606.ENSP00000313504	0.703	Phosphorylase b kinase regulatory subunit beta
15	9606.ENSP00000451828	0.699	RAC-alpha serine/threonine-protein kinase
16	9606.ENSP00000380109	0.683	NF-kappa-B inhibitor delta
17	9606.ENSP00000361411	0.665	Zinc finger CCHC-type containing 24
18	9606.ENSP00000369674	0.657	B-cell CLL/lymphoma 7 protein family member C
19	9606.ENSP00000468782	0.649	Zinc finger and BTB domain-containing protein 7C
20	9606.ENSP00000262622	0.645	Carbohydrate sulfotransferase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.324	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.955	regulation of cellular process
GO:0048522	0.937	positive regulation of cellular process
GO:0071840	0.926	cellular component organization or biogenesis
GO:0070507	0.912	regulation of microtubule cytoskeleton organization
GO:0007017	0.894	microtubule-based process
GO:0051049	0.877	regulation of transport
GO:0051179	0.872	localization
GO:1902903	0.862	regulation of supramolecular fiber organization
GO:0071704	0.854	organic substance metabolic process
GO:0044238	0.824	primary metabolic process
GO:0031110	0.824	regulation of microtubule polymerization or depolymerization
GO:0019222	0.811	regulation of metabolic process
GO:0032502	0.803	developmental process
GO:0044237	0.803	cellular metabolic process
GO:0043254	0.798	regulation of protein-containing complex assembly
GO:0060255	0.795	regulation of macromolecule metabolic process
GO:0051050	0.792	positive regulation of transport
GO:0080090	0.791	regulation of primary metabolic process
GO:0051171	0.791	regulation of nitrogen compound metabolic process
GO:0016043	0.778	cellular component organization
GO:0006807	0.771	nitrogen compound metabolic process
GO:0031323	0.747	regulation of cellular metabolic process
GO:0010639	0.740	negative regulation of organelle organization
GO:0044085	0.734	cellular component biogenesis
GO:0051641	0.732	cellular localization
GO:0051494	0.725	negative regulation of cytoskeleton organization
GO:1901564	0.720	organonitrogen compound metabolic process
GO:0043170	0.716	macromolecule metabolic process
GO:0031399	0.715	regulation of protein modification process
GO:0009893	0.702	positive regulation of metabolic process
GO:0010941	0.701	regulation of cell death
GO:0044249	0.701	cellular biosynthetic process
GO:0042157	0.689	lipoprotein metabolic process
GO:0051234	0.687	establishment of localization
GO:0043543	0.686	protein acylation
GO:0032271	0.683	regulation of protein polymerization
GO:1902904	0.681	negative regulation of supramolecular fiber organization
GO:0034645	0.674	cellular macromolecule biosynthetic process
GO:0051649	0.667	establishment of localization in cell
GO:0018193	0.659	peptidyl-amino acid modification
GO:0006497	0.654	protein lipidation
GO:0044091	0.652	membrane biogenesis
GO:0018345	0.635	protein palmitoylation
GO:0051174	0.632	regulation of phosphorus metabolic process
GO:0010604	0.618	positive regulation of macromolecule metabolic process
GO:0032880	0.615	regulation of protein localization
GO:0051173	0.607	positive regulation of nitrogen compound metabolic process
GO:0018198	0.585	peptidyl-cysteine modification
GO:0033036	0.564	macromolecule localization
GO:0046907	0.551	intracellular transport
GO:0031113	0.551	regulation of microtubule polymerization
GO:0034762	0.544	regulation of transmembrane transport
GO:1903829	0.542	positive regulation of protein localization
GO:0051130	0.539	positive regulation of cellular component organization
GO:0071702	0.531	organic substance transport
GO:0031111	0.511	negative regulation of microtubule polymerization or depolymerization
GO:0010827	0.502	regulation of glucose transmembrane transport
GO:0048869	0.493	cellular developmental process
GO:1904375	0.472	regulation of protein localization to cell periphery
GO:1905475	0.471	regulation of protein localization to membrane
GO:0045444	0.465	fat cell differentiation
GO:0051247	0.447	positive regulation of protein metabolic process
GO:0034764	0.388	positive regulation of transmembrane transport
GO:1903076	0.369	regulation of protein localization to plasma membrane
GO:0010828	0.324	positive regulation of glucose transmembrane transport
GO:0031401	0.321	positive regulation of protein modification process
GO:1904377	0.303	positive regulation of protein localization to cell periphery
GO:1905477	0.301	positive regulation of protein localization to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005802	0.988	trans-Golgi network
GO:0005829	0.943	cytosol
GO:0031982	0.746	vesicle
GO:0031090	0.583	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]