StarFunc result for job id Q96E09

User Input

>input (287 residues)
MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARR
NSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEES
FSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTT
RFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVS
SDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96E09	0.999	0.999	5.835E-41	287	1.000	1.000	Q96E09.pdb.gz	PBIR1_HUMAN PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1
2	AFDB:O13791	0.089	0.067	3.462E-2	433	0.188	0.125	O13791.pdb.gz	SLT1_SCHPO Protein slt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slt1 PE=1 SV=3
3	AFDB:Q38DL8	0.114	0.053	9.637E-2	746	0.143	0.055	Q38DL8.pdb.gz	Q38DL8_TRYB2 DNA repair protein RAD2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2870 PE=3 SV=1
4	AFDB:A0A024R099	0.102	0.091	1.781E-1	333	0.209	0.180	A0A024R099.pdb.gz
5	AFDB:O75096	0.110	0.025	1.781E-1	1905	0.143	0.022	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
6	AFDB:Q6RZZ9	0.118	0.038	1.781E-1	1265	0.167	0.038	Q6RZZ9.pdb.gz	KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum OX=44689 GN=kif13 PE=1 SV=1
7	AFDB:Q57YV4	0.129	0.047	1.907E-1	1028	0.139	0.039	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
8	AFDB:Q8N9Y4	0.082	0.071	1.907E-1	354	0.188	0.153	Q8N9Y4.pdb.gz	F181A_HUMAN Protein FAM181A OS=Homo sapiens OX=9606 GN=FAM181A PE=1 SV=3
9	AFDB:Q06507	0.081	0.073	2.042E-1	349	0.150	0.123	Q06507.pdb.gz	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2
10	AFDB:Q54E42	0.105	0.019	2.042E-1	2536	0.153	0.017	Q54E42.pdb.gz	Q54E42_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt3 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E09	0.0	578	287	1.000	1.000	PBIR1_HUMAN PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1
2	Q6P4D5	3.74e-31	117	195	0.230	0.338	PBIR3_HUMAN PABIR family member 1 OS=Homo sapiens OX=9606 GN=PABIR3 PE=1 SV=1
3	A0A1B0GTN9	1.6	32.7	1192	0.101	0.024	A0A1B0GTN9_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
4	Q9T0I9	3.7	31.6	375	0.084	0.064	Q9T0I9_ARATH Calcium-binding EF-hand family protein OS=Arabidopsis thaliana OX=3702 GN=SCS PE=1 SV=1
5	Q9VV79	6.4	30.8	1146	0.136	0.034	Q9VV79_DROME BcDNA.LD24702 OS=Drosophila melanogaster OX=7227 GN=spd-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377807

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325074	0.847	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
2	9606.ENSP00000378323	0.842	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
3	9606.ENSP00000370527	0.807	Calcipressin-1
4	9606.ENSP00000324804	0.803	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
5	9606.ENSP00000419592	0.800	Protein FAM122B
6	9606.ENSP00000234310	0.681	Calcineurin subunit B type 1
7	9606.ENSP00000335083	0.677	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
8	9606.ENSP00000453293	0.643	Amyloid-beta A4 precursor protein-binding family A member 2
9	9606.ENSP00000265382	0.556	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
10	9606.ENSP00000287878	0.506	5'-AMP-activated protein kinase subunit gamma-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004865	1.000	protein serine/threonine phosphatase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050789	0.966	regulation of biological process
GO:0080090	0.958	regulation of primary metabolic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0007165	0.948	signal transduction
GO:0051173	0.931	positive regulation of nitrogen compound metabolic process
GO:0031323	0.928	regulation of cellular metabolic process
GO:0010604	0.924	positive regulation of macromolecule metabolic process
GO:0048523	0.898	negative regulation of cellular process
GO:0048522	0.894	positive regulation of cellular process
GO:0035556	0.893	intracellular signal transduction
GO:0051246	0.856	regulation of protein metabolic process
GO:0031325	0.817	positive regulation of cellular metabolic process
GO:1901987	0.762	regulation of cell cycle phase transition
GO:0051247	0.748	positive regulation of protein metabolic process
GO:1901990	0.730	regulation of mitotic cell cycle phase transition
GO:1901988	0.727	negative regulation of cell cycle phase transition
GO:0045930	0.703	negative regulation of mitotic cell cycle
GO:1903050	0.686	regulation of proteolysis involved in protein catabolic process
GO:0009894	0.658	regulation of catabolic process
GO:1903047	0.654	mitotic cell cycle process
GO:0000075	0.640	cell cycle checkpoint signaling
GO:0007093	0.610	mitotic cell cycle checkpoint signaling
GO:0045862	0.600	positive regulation of proteolysis
GO:0010389	0.595	regulation of G2/M transition of mitotic cell cycle
GO:1901991	0.595	negative regulation of mitotic cell cycle phase transition
GO:1903052	0.576	positive regulation of proteolysis involved in protein catabolic process
GO:0032434	0.576	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:2000060	0.560	positive regulation of ubiquitin-dependent protein catabolic process
GO:1902750	0.559	negative regulation of cell cycle G2/M phase transition
GO:0051128	0.524	regulation of cellular component organization
GO:0032436	0.522	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0010972	0.516	negative regulation of G2/M transition of mitotic cell cycle
GO:0040008	0.403	regulation of growth
GO:0008152	0.354	metabolic process
GO:0071704	0.334	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043233	0.932	organelle lumen
GO:0070013	0.882	intracellular organelle lumen
GO:0005829	0.464	cytosol
GO:0031981	0.334	nuclear lumen
GO:0005654	0.306	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]