StarFunc result for job id Q96E11

User Input

>input (262 residues)
MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKA
KAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIA
VVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRV
PIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQ
MADDTVAELDRHLAVKTKELLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96E11	1.000	1.000	2.866E-42	262	1.000	1.000	Q96E11.pdb.gz	RRFM_HUMAN Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF PE=1 SV=1
2	AFDB:Q9D6S7	0.752	0.752	1.588E-36	262	0.851	0.851	Q9D6S7.pdb.gz	RRFM_MOUSE Ribosome-recycling factor, mitochondrial OS=Mus musculus OX=10090 GN=Mrrf PE=1 SV=1
3	PDB:7nshBG	0.473	0.624	3.858E-27	196	0.748	1.000	7nshBG.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
4	AFDB:Q6NQM0	0.559	0.549	1.131E-15	267	0.221	0.217	Q6NQM0.pdb.gz	Q6NQM0_ARATH Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g01800 PE=1 SV=1
5	AFDB:Q9M1X0	0.581	0.557	1.134E-14	275	0.233	0.222	Q9M1X0.pdb.gz	RRFC_ARATH Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RRF PE=2 SV=2
6	AFDB:O82853	0.550	0.737	4.479E-13	185	0.202	0.286	O82853.pdb.gz	RRF_PSEAE Ribosome-recycling factor OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=frr PE=3 SV=1
7	AFDB:O51147	0.590	0.810	5.893E-13	184	0.176	0.250	O51147.pdb.gz	RRF_BORBU Ribosome-recycling factor OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=frr PE=3 SV=1
8	AFDB:P0A805	0.590	0.802	8.191E-13	185	0.198	0.281	P0A805.pdb.gz	RRF_ECOLI Ribosome-recycling factor OS=Escherichia coli (strain K12) OX=83333 GN=frr PE=1 SV=1
9	PDB:4kddA	0.544	0.735	1.067E-12	184	0.191	0.272	4kddA.pdb.gz	Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
10	AFDB:P9WGY1	0.560	0.753	1.498E-12	185	0.191	0.270	P9WGY1.pdb.gz	RRF_MYCTU Ribosome-recycling factor OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=frr PE=1 SV=1
11	PDB:1ek8A	0.430	0.585	2.866E-12	185	0.206	0.292	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
12	AFDB:O74734	0.618	0.659	1.080E-11	244	0.183	0.197	O74734.pdb.gz	RRF1_SCHPO Putative ribosomal recycling factor, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrf1 PE=3 SV=1
13	AFDB:Q8IFQ7	0.512	0.505	5.303E-11	266	0.164	0.162	Q8IFQ7.pdb.gz	Q8IFQ7_PLAF7 Ribosome-recycling factor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0420400 PE=3 SV=1
14	PDB:5h7dA	0.164	0.100	6.314E-2	495	0.076	0.040	5h7dA.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
15	PDB:6osaR	0.142	0.123	1.999E-1	321	0.057	0.047	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
16	PDB:3nbxX	0.152	0.105	2.778E-1	481	0.084	0.046	3nbxX.pdb.gz	Structure of RavA MoxR AAA+ protein reveals the design principles of a molecular cage modulating the inducible lysine decarboxylase activity
17	PDB:2hf2B	0.147	0.143	5.367E-1	270	0.038	0.037	2hf2B.pdb.gz
18	PDB:7myjC	0.083	0.051	5.670E-1	465	0.076	0.043	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
19	PDB:1gmeA	0.108	0.164	6.327E-1	150	0.031	0.053	1gmeA.pdb.gz
20	PDB:1d1rA	0.132	0.350	6.684E-1	83	0.042	0.133	1d1rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E11	0.0	538	262	1.000	1.000	RRFM_HUMAN Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF PE=1 SV=1
2	Q9D6S7	1.85e-159	445	262	0.851	0.851	RRFM_MOUSE Ribosome-recycling factor, mitochondrial OS=Mus musculus OX=10090 GN=Mrrf PE=1 SV=1
3	Q6NQM0	2.73e-18	84.0	267	0.183	0.180	Q6NQM0_ARATH Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g01800 PE=1 SV=1
4	O82853	3.53e-17	79.3	185	0.198	0.281	RRF_PSEAE Ribosome-recycling factor OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=frr PE=3 SV=1
5	P0A805	6.72e-16	75.9	185	0.218	0.308	RRF_ECOLI Ribosome-recycling factor OS=Escherichia coli (strain K12) OX=83333 GN=frr PE=1 SV=1
6	P9WGY1	7.15e-16	75.5	185	0.202	0.286	RRF_MYCTU Ribosome-recycling factor OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=frr PE=1 SV=1
7	O51147	1.21e-13	69.7	184	0.206	0.293	RRF_BORBU Ribosome-recycling factor OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=frr PE=3 SV=1
8	Q9M1X0	1.03e-12	68.6	275	0.221	0.211	RRFC_ARATH Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RRF PE=2 SV=2
9	F1M614	0.031	38.1	3117	0.115	0.010	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4
10	A0A0G2JWX2	0.13	36.2	3121	0.126	0.011	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
11	Q12967	0.34	34.7	914	0.061	0.018	GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens OX=9606 GN=RALGDS PE=1 SV=2
12	P24043	0.71	33.9	3122	0.115	0.010	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
13	F4JLE5	0.73	33.5	554	0.134	0.063	SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana OX=3702 GN=SFH1 PE=2 SV=1
14	A0A1D8PE76	2.3	32.3	1223	0.073	0.016	A0A1D8PE76_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRE1 PE=4 SV=1
15	Q8NFZ0	3.0	32.0	1043	0.176	0.044	FBH1_HUMAN F-box DNA helicase 1 OS=Homo sapiens OX=9606 GN=FBH1 PE=1 SV=2
16	Q60675	3.7	31.6	3118	0.118	0.010	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
17	P16118	3.8	31.2	471	0.141	0.079	F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=PFKFB1 PE=1 SV=3
18	A0A0B4LFP7	6.7	30.8	1248	0.073	0.015	A0A0B4LFP7_DROME Thin, isoform D OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
19	A0A0B4LFW8	7.2	30.4	1277	0.073	0.015	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
20	Q7JUV6	7.3	30.4	1353	0.073	0.014	Q7JUV6_DROME GH06739p OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00244 14-3-3	8.3	17.4	14-3-3 protein
2	PF07464 ApoLp-III	1.7e+02	13.7	Apolipophorin-III precursor (apoLp-III)
3	PF16289 PIN_12	3.1e+02	13.2	PIN domain
4	PF01765 RRF	1.8e-38	143.5	Ribosome recycling factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258455	0.986	Mitochondrial ribosomal protein S9
2	9606.ENSP00000341082	0.983	Mitochondrial ribosomal protein L20
3	9606.ENSP00000362036	0.981	Mitochondrial ribosomal protein S16
4	9606.ENSP00000301585	0.980	Peptidyl-tRNA hydrolase ICT1, mitochondrial
5	9606.ENSP00000419038	0.978	Elongation factor G, mitochondrial
6	9606.ENSP00000377486	0.977	Mitochondrial ribosomal protein L19
7	9606.ENSP00000225969	0.972	Mitochondrial ribosomal protein L27
8	9606.ENSP00000053468	0.970	Mitochondrial ribosomal protein S10
9	9606.ENSP00000354580	0.969	Mitochondrial ribosomal protein L21
10	9606.ENSP00000357823	0.967	Mitochondrial ribosomal protein L9
11	9606.ENSP00000288937	0.964	Mitochondrial ribosomal protein L17
12	9606.ENSP00000306548	0.962	Mitochondrial ribosomal protein L13
13	9606.ENSP00000360850	0.962	Mitochondrial ribosomal protein S2
14	9606.ENSP00000245539	0.960	Mitochondrial ribosomal protein S7
15	9606.ENSP00000223324	0.959	Mitochondrial ribosomal protein L32
16	9606.ENSP00000296102	0.958	Mitochondrial ribosomal protein L33
17	9606.ENSP00000382250	0.958	Mitochondrial ribosomal protein S6
18	9606.ENSP00000296805	0.956	Ribosome-releasing factor 2, mitochondrial
19	9606.ENSP00000423399	0.955	Mitochondrial ribosomal protein L36
20	9606.ENSP00000313877	0.952	Elongation factor Ts, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.695	organic cyclic compound binding
GO:0003676	0.404	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1903008	0.983	organelle disassembly
GO:0071704	0.758	organic substance metabolic process
GO:0044238	0.744	primary metabolic process
GO:0044237	0.735	cellular metabolic process
GO:0006807	0.727	nitrogen compound metabolic process
GO:0043170	0.647	macromolecule metabolic process
GO:0034641	0.631	cellular nitrogen compound metabolic process
GO:1901564	0.460	organonitrogen compound metabolic process
GO:1901576	0.448	organic substance biosynthetic process
GO:0044260	0.438	cellular macromolecule metabolic process
GO:0010467	0.431	gene expression
GO:0044249	0.417	cellular biosynthetic process
GO:0044271	0.413	cellular nitrogen compound biosynthetic process
GO:1901566	0.410	organonitrogen compound biosynthetic process
GO:0019538	0.386	protein metabolic process
GO:0006412	0.379	translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.914	mitochondrial matrix
GO:0016020	0.547	membrane
GO:0043232	0.463	intracellular non-membrane-bounded organelle
GO:0032991	0.452	protein-containing complex
GO:0031981	0.342	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]