StarFunc result for job id Q96E14

User Input

>input (147 residues)
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96E14	1.000	1.000	5.550E-30	147	1.000	1.000	Q96E14.pdb.gz	RMI2_HUMAN RecQ-mediated genome instability protein 2 OS=Homo sapiens OX=9606 GN=RMI2 PE=1 SV=2
2	PDB:3mxnB	0.886	0.994	4.933E-26	131	0.891	1.000	3mxnB.pdb.gz
3	PDB:4dayB	0.724	0.934	1.052E-18	113	0.769	1.000	4dayB.pdb.gz	Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
4	AFDB:Q8RX36	0.678	0.724	7.646E-9	137	0.293	0.314	Q8RX36.pdb.gz	Q8RX36_ARATH RecQ-mediated instability-like protein OS=Arabidopsis thaliana OX=3702 GN=RMI2 PE=1 SV=1
5	AFDB:Q6IP18	0.665	0.375	2.245E-6	276	0.184	0.098	Q6IP18.pdb.gz	RFA2A_XENLA Replication protein A 32 kDa subunit-A OS=Xenopus laevis OX=8355 GN=rpa2-a PE=1 SV=1
6	AFDB:Q13156	0.615	0.364	2.519E-6	261	0.238	0.134	Q13156.pdb.gz	RFA4_HUMAN Replication protein A 30 kDa subunit OS=Homo sapiens OX=9606 GN=RPA4 PE=1 SV=2
7	AFDB:Q95Y97	0.555	0.306	3.169E-6	288	0.177	0.090	Q95Y97.pdb.gz	Q95Y97_CAEEL Replication protein A C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rpa-2 PE=1 SV=1
8	PDB:2pi2A	0.627	0.705	3.435E-6	129	0.170	0.194	2pi2A.pdb.gz
9	AFDB:P15927	0.654	0.373	6.310E-6	270	0.190	0.104	P15927.pdb.gz	RFA2_HUMAN Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1
10	AFDB:Q57ZN9	0.624	0.382	6.310E-6	255	0.231	0.133	Q57ZN9.pdb.gz	Q57ZN9_TRYB2 Replication Factor A 28 kDa subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.900 PE=3 SV=1
11	AFDB:Q62193	0.668	0.384	6.683E-6	270	0.197	0.107	Q62193.pdb.gz	RFA2_MOUSE Replication protein A 32 kDa subunit OS=Mus musculus OX=10090 GN=Rpa2 PE=1 SV=2
12	AFDB:Q6H7J5	0.597	0.318	8.904E-6	298	0.204	0.101	Q6H7J5.pdb.gz	RFA2B_ORYSJ Replication protein A 32 kDa subunit B OS=Oryza sativa subsp. japonica OX=39947 GN=RPA2B PE=1 SV=1
13	AFDB:Q9VIH1	0.590	0.372	1.120E-5	246	0.177	0.106	Q9VIH1.pdb.gz	Q9VIH1_DROME CG9273 protein OS=Drosophila melanogaster OX=7227 GN=RPA2 PE=1 SV=2
14	PDB:6w6wC	0.629	0.307	3.042E-5	323	0.150	0.068	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:3kf6B	0.565	0.761	4.053E-5	105	0.095	0.133	3kf6B.pdb.gz
16	PDB:1nnxA	0.441	0.651	1.139E-4	93	0.129	0.204	1nnxA.pdb.gz
17	PDB:8d0bC	0.454	0.531	1.607E-4	121	0.122	0.149	8d0bC.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
18	PDB:1bbuA	0.397	0.131	2.544E-4	486	0.095	0.029	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
19	PDB:1e1tA	0.400	0.134	3.022E-4	485	0.116	0.035	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
20	PDB:4j15A	0.377	0.145	5.066E-4	431	0.156	0.053	4j15A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E14	4.22e-103	293	147	1.000	1.000	RMI2_HUMAN RecQ-mediated genome instability protein 2 OS=Homo sapiens OX=9606 GN=RMI2 PE=1 SV=2
2	Q8RX36	5.69e-08	50.8	137	0.313	0.336	Q8RX36_ARATH RecQ-mediated instability-like protein OS=Arabidopsis thaliana OX=3702 GN=RMI2 PE=1 SV=1
3	Q9NRL3	6.8	29.3	753	0.109	0.021	STRN4_HUMAN Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2
4	Q54VB6	8.0	28.9	628	0.116	0.027	PSRA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit psrA OS=Dictyostelium discoideum OX=44689 GN=psrA PE=3 SV=1
5	C8XTB7	8.7	28.9	760	0.102	0.020	C8XTB7_DANRE Pendrin OS=Danio rerio OX=7955 GN=si:dkey-31f5.9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16100 RMI2	2.6e-38	142.3	RecQ-mediated genome instability protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317039	0.999	RecQ-mediated genome instability protein 1
2	9606.ENSP00000442336	0.999	DNA topoisomerase 3-alpha
3	9606.ENSP00000267430	0.994	Fanconi anemia group M protein
4	9606.ENSP00000347232	0.990	Bloom syndrome protein
5	9606.ENSP00000318977	0.984	Flap endonuclease GEN homolog 1
6	9606.ENSP00000307853	0.969	Crossover junction endonuclease MUS81
7	9606.ENSP00000376952	0.965	Crossover junction endonuclease EME1
8	9606.ENSP00000294008	0.958	Structure-specific endonuclease subunit SLX4
9	9606.ENSP00000373952	0.955	Fanconi anemia group A protein
10	9606.ENSP00000333283	0.947	Fanconi anemia core complex-associated protein 100
11	9606.ENSP00000353332	0.946	Regulator of telomere elongation helicase 1
12	9606.ENSP00000457353	0.941	Probable crossover junction endonuclease EME2
13	9606.ENSP00000263681	0.939	DNA polymerase delta subunit 3
14	9606.ENSP00000372088	0.937	DNA repair protein RAD51 homolog 1
15	9606.ENSP00000216367	0.936	DNA polymerase epsilon subunit 2
16	9606.ENSP00000310520	0.935	DNA repair endonuclease XPF
17	9606.ENSP00000308583	0.931	Centromere protein S
18	9606.ENSP00000368458	0.929	Proliferating cell nuclear antigen
19	9606.ENSP00000355506	0.925	Exonuclease 1
20	9606.ENSP00000013807	0.922	DNA excision repair protein ERCC-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.419	heterocyclic compound binding
GO:0097159	0.419	organic cyclic compound binding
GO:0003676	0.395	nucleic acid binding
GO:0003677	0.335	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0010564	0.992	regulation of cell cycle process
GO:0006302	0.990	double-strand break repair
GO:0006310	0.987	DNA recombination
GO:0000724	0.966	double-strand break repair via homologous recombination
GO:0033044	0.958	regulation of chromosome organization
GO:0051983	0.930	regulation of chromosome segregation
GO:0033045	0.872	regulation of sister chromatid segregation
GO:0071840	0.393	cellular component organization or biogenesis
GO:0016043	0.364	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005694	0.998	chromosome
GO:1902494	0.997	catalytic complex
GO:0016604	0.996	nuclear body
GO:0016607	0.990	nuclear speck
GO:0098687	0.608	chromosomal region
GO:0031422	0.534	RecQ family helicase-topoisomerase III complex
GO:0140513	0.429	nuclear protein-containing complex
GO:0000782	0.377	telomere cap complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]