StarFunc result for job id Q96E22

User Input

>input (293 residues)
MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPP
AVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASL
VVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQ
VLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDL
VLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99LJ8	0.657	0.649	2.206E-44	297	0.904	0.892	Q99LJ8.pdb.gz	NGBR_MOUSE Dehydrodolichyl diphosphate synthase complex subunit Nus1 OS=Mus musculus OX=10090 GN=Nus1 PE=2 SV=1
2	AFDB:Q6DHR8	0.672	0.716	5.521E-32	274	0.556	0.595	Q6DHR8.pdb.gz	NGBR_DANRE Dehydrodolichyl diphosphate synthase complex subunit nus1 OS=Danio rerio OX=7955 GN=nus1 PE=2 SV=1
3	AFDB:Q12063	0.582	0.467	4.737E-16	375	0.246	0.192	Q12063.pdb.gz	UPPS_YEAST Dehydrodolichyl diphosphate synthase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUS1 PE=1 SV=1
4	AFDB:Q9Y7K8	0.586	0.657	2.873E-15	258	0.242	0.275	Q9Y7K8.pdb.gz	UPPS_SCHPO Dehydrodolichyl diphosphate synthase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nus1 PE=1 SV=1
5	AFDB:Q8H0V2	0.511	0.583	1.317E-11	254	0.191	0.220	Q8H0V2.pdb.gz	Q8H0V2_ARATH ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyldiphosphate specific] OS=Arabidopsis thaliana OX=3702 GN=LEW1 PE=1 SV=1
6	AFDB:Q9VPX8	0.515	0.539	5.974E-11	278	0.229	0.241	Q9VPX8.pdb.gz	Q9VPX8_DROME ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyldiphosphate specific] OS=Drosophila melanogaster OX=7227 GN=Tango14 PE=2 SV=1
7	AFDB:A0R2W4	0.481	0.529	9.185E-10	263	0.184	0.205	A0R2W4.pdb.gz	ZFPP_MYCS2 (2Z,6E)-farnesyl diphosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=uppS PE=1 SV=1
8	AFDB:Q8THV9	0.485	0.617	6.632E-9	224	0.123	0.161	Q8THV9.pdb.gz	Q8THV9_METAC Undecaprenyl diphosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=MA_4402 PE=4 SV=1
9	AFDB:Q47SS3	0.476	0.538	9.400E-9	254	0.167	0.193	Q47SS3.pdb.gz	ZFPP_THEFY (2Z,6E)-farnesyl diphosphate synthase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_0456 PE=1 SV=1
10	AFDB:K7W9N9	0.483	0.495	9.963E-9	285	0.140	0.144	K7W9N9.pdb.gz	CPT6_SOLLC (2Z,6Z)-farnesyl diphosphate synthase CPT6, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT6 PE=1 SV=2
11	PDB:7cpmA	0.441	0.521	2.463E-8	244	0.154	0.184	7cpmA.pdb.gz
12	PDB:7payA	0.483	0.434	7.014E-8	329	0.137	0.122	7payA.pdb.gz	Structural basis for long-chain isoprenoid synthesis by cis -prenyltransferases.
13	PDB:6imeA	0.454	0.465	9.942E-8	285	0.133	0.137	6imeA.pdb.gz	Substrate-analogue complex structure of Mycobacterium tuberculosis decaprenyl diphosphate synthase.
14	PDB:5zheA	0.443	0.612	2.521E-7	206	0.130	0.184	5zheA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
15	PDB:5kh4A	0.441	0.545	1.018E-6	231	0.123	0.156	5kh4A.pdb.gz	Discovery and Characterization of a Class of Pyrazole Inhibitors of Bacterial Undecaprenyl Pyrophosphate Synthase.
16	PDB:1x07A	0.430	0.531	1.143E-6	231	0.133	0.169	1x07A.pdb.gz	Crystal structures of undecaprenyl pyrophosphate synthase in complex with magnesium, isopentenyl pyrophosphate, and farnesyl thiopyrophosphate: roles of the metal ion and conserved residues in catalysis.
17	PDB:3wqmA	0.426	0.425	1.546E-3	294	0.102	0.102	3wqmA.pdb.gz	Structure and inhibition of tuberculosinol synthase and decaprenyl diphosphate synthase from Mycobacterium tuberculosis.
18	PDB:6tnmA	0.289	0.135	1.053E-2	719	0.085	0.035	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
19	PDB:3jyoA	0.263	0.271	1.996E-2	282	0.078	0.082	3jyoA.pdb.gz	Enzyme-substrate complexes of the quinate/shikimate dehydrogenase from Corynebacterium glutamicum enable new insights in substrate and cofactor binding, specificity, and discrimination.
20	PDB:2pt6A	0.168	0.173	3.571E-2	281	0.065	0.068	2pt6A.pdb.gz	Crystal structure of Plasmodium falciparum spermidine synthase in complex with the substrate decarboxylated S-adenosylmethionine and the potent inhibitors 4MCHA and AdoDATO.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E22	0.0	607	293	1.000	1.000	NGBR_HUMAN Dehydrodolichyl diphosphate synthase complex subunit NUS1 OS=Homo sapiens OX=9606 GN=NUS1 PE=1 SV=1
2	Q99LJ8	0.0	504	297	0.904	0.892	NGBR_MOUSE Dehydrodolichyl diphosphate synthase complex subunit Nus1 OS=Mus musculus OX=10090 GN=Nus1 PE=2 SV=1
3	Q6DHR8	9.12e-109	318	274	0.560	0.599	NGBR_DANRE Dehydrodolichyl diphosphate synthase complex subunit nus1 OS=Danio rerio OX=7955 GN=nus1 PE=2 SV=1
4	Q12063	3.46e-21	94.4	375	0.198	0.155	UPPS_YEAST Dehydrodolichyl diphosphate synthase complex subunit NUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUS1 PE=1 SV=1
5	Q9Y7K8	7.43e-20	88.6	258	0.218	0.248	UPPS_SCHPO Dehydrodolichyl diphosphate synthase complex subunit nus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nus1 PE=1 SV=1
6	Q9VPX8	1.94e-14	73.9	278	0.232	0.245	Q9VPX8_DROME ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyldiphosphate specific] OS=Drosophila melanogaster OX=7227 GN=Tango14 PE=2 SV=1
7	Q8H0V2	3.58e-13	70.1	254	0.154	0.177	Q8H0V2_ARATH ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyldiphosphate specific] OS=Arabidopsis thaliana OX=3702 GN=LEW1 PE=1 SV=1
8	A0R2W4	9.00e-06	48.5	263	0.171	0.190	ZFPP_MYCS2 (2Z,6E)-farnesyl diphosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=uppS PE=1 SV=1
9	Q47SS3	2.11e-04	44.3	254	0.164	0.189	ZFPP_THEFY (2Z,6E)-farnesyl diphosphate synthase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_0456 PE=1 SV=1
10	P9WFF5	3.82e-04	43.5	262	0.157	0.176	ZFPP_MYCTU (2Z,6E)-farnesyl diphosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1086 PE=1 SV=1
11	P60472	0.001	42.4	253	0.154	0.178	UPPS_ECOLI Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) OS=Escherichia coli (strain K12) OX=83333 GN=ispU PE=1 SV=1
12	Q8TJQ7	0.048	37.4	298	0.140	0.138	UPPS_METAC Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=uppS PE=3 SV=1
13	Q86SQ9	0.058	37.0	333	0.154	0.135	DHDDS_HUMAN Dehydrodolichyl diphosphate synthase complex subunit DHDDS OS=Homo sapiens OX=9606 GN=DHDDS PE=1 SV=3
14	P9WFF7	0.078	36.6	296	0.106	0.105	DPDS_MYCTU Decaprenyl diphosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=uppS PE=1 SV=1
15	Q6NW40	0.56	34.3	437	0.065	0.043	RGMB_HUMAN Repulsive guidance molecule B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3
16	Q8RX73	0.67	33.5	302	0.085	0.083	DDPS3_ARATH Dehydrodolichyl diphosphate synthase 3 OS=Arabidopsis thaliana OX=3702 GN=At5g58780 PE=2 SV=1
17	C1K5M2	0.79	33.5	303	0.078	0.076	CPT1_SOLLC Dimethylallylcistransferase CPT1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT1 PE=1 SV=1
18	K7X479	1.0	33.1	313	0.096	0.089	CPT5_SOLLC Dehydrodolichyl diphosphate synthase CPT5, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT5 PE=1 SV=1
19	O80458	1.1	33.1	303	0.096	0.092	DDPS1_ARATH Dehydrodolichyl diphosphate synthase 1 OS=Arabidopsis thaliana OX=3702 GN=DPS PE=1 SV=2
20	A0R0S4	1.2	32.7	293	0.096	0.096	DPDS_MYCS2 Decaprenyl diphosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=uppS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01255 Prenyltransf	1.8e-05	35.9	Putative undecaprenyl diphosphate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353104	0.997	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
2	9606.ENSP00000337838	0.988	Reticulon-4
3	9606.ENSP00000282841	0.944	Geranylgeranyl pyrophosphate synthase
4	9606.ENSP00000349078	0.926	Farnesyl pyrophosphate synthase
5	9606.ENSP00000365388	0.923	Decaprenyl-diphosphate synthase subunit 1
6	9606.ENSP00000358033	0.922	Decaprenyl-diphosphate synthase subunit 2
7	9606.ENSP00000303423	0.916	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
8	9606.ENSP00000246166	0.912	Protein farnesyltransferase subunit beta
9	9606.ENSP00000480828	0.842	Squalene synthase
10	9606.ENSP00000264228	0.771	Polyprenol reductase
11	9606.ENSP00000361667	0.741	Dolichol kinase
12	9606.ENSP00000326869	0.712	ORM1-like protein 1
13	9606.ENSP00000385689	0.690	GRAM domain-containing protein 4
14	9606.ENSP00000345528	0.682	Solute carrier family 35 member F6
15	9606.ENSP00000262554	0.675	Serine palmitoyltransferase 1
16	9606.ENSP00000374152	0.673	SET and MYND domain-containing protein 5
17	9606.ENSP00000348673	0.671	Zinc finger protein 770
18	9606.ENSP00000451112	0.668	Epididymal secretory protein E1
19	9606.ENSP00000361625	0.646	Dolichyldiphosphatase 1
20	9606.ENSP00000321810	0.642	tRNA dimethylallyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004659	1.000	prenyltransferase activity
GO:0005488	0.986	binding
GO:0005515	0.922	protein binding
GO:0045547	0.361	dehydrodolichyl diphosphate synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044249	0.990	cellular biosynthetic process
GO:1901137	0.990	carbohydrate derivative biosynthetic process
GO:1901566	0.990	organonitrogen compound biosynthetic process
GO:0036211	0.988	protein modification process
GO:0044260	0.985	cellular macromolecule metabolic process
GO:0006486	0.978	protein glycosylation
GO:0065007	0.975	biological regulation
GO:0050789	0.970	regulation of biological process
GO:1905952	0.901	regulation of lipid localization
GO:0032368	0.782	regulation of lipid transport
GO:0050794	0.747	regulation of cellular process
GO:0032371	0.738	regulation of sterol transport
GO:0006629	0.694	lipid metabolic process
GO:0044255	0.624	cellular lipid metabolic process
GO:0008610	0.565	lipid biosynthetic process
GO:0032374	0.487	regulation of cholesterol transport
GO:0044281	0.438	small molecule metabolic process
GO:1901615	0.302	organic hydroxy compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.997	endomembrane system
GO:0005737	0.997	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0032991	0.983	protein-containing complex
GO:0031090	0.982	organelle membrane
GO:0031984	0.969	organelle subcompartment
GO:0042175	0.961	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.958	endoplasmic reticulum subcompartment
GO:0005789	0.954	endoplasmic reticulum membrane
GO:1902494	0.793	catalytic complex
GO:1990234	0.538	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.

[back to server]